Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rab GDP dissociation inhibitor beta (Gdi2) Recombinant Protein | Gdi2 recombinant protein

Recombinant Mouse Rab GDP dissociation inhibitor beta (Gdi2)

Gene Names
Gdi2; GDIB; Gdi3; GDI-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rab GDP dissociation inhibitor beta (Gdi2); Recombinant Mouse Rab GDP dissociation inhibitor beta (Gdi2); Gdi2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-445, full length protein
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED
Sequence Length
445
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gdi2 recombinant protein
GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion
deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,658 Da
NCBI Official Full Name
rab GDP dissociation inhibitor beta
NCBI Official Synonym Full Names
guanosine diphosphate (GDP) dissociation inhibitor 2
NCBI Official Symbol
Gdi2
NCBI Official Synonym Symbols
GDIB; Gdi3; GDI-B
NCBI Protein Information
rab GDP dissociation inhibitor beta
UniProt Protein Name
Rab GDP dissociation inhibitor beta
UniProt Gene Name
Gdi2
UniProt Synonym Gene Names
Gdi3; Rab GDI beta; GDI-2

Uniprot Description

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Research Articles on Gdi2

Similar Products

Product Notes

The Gdi2 gdi2 (Catalog #AAA1363219) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-445, full length protein. The amino acid sequence is listed below: MNEEYDVIVL GTGLTECILS GIMSVNGKKV LHMDQNPYYG GESASITPLE DLYKRFKLPG QPPASMGRGR DWNVDLIPKF LMANGQLVKM LLFTEVTRYM DFKVIEGSFV YKGGKIYKVP STEAEALASS LMGLFEKRRF RKFLVYVANF DEKDPRTFEG VDPKKTSMRD VYKKFDLGQD VIDFTGHSLA LYRTDDYLDQ PCCETINRIK LYSESLARYG KSPYLYPLYG LGELPQGFAR LSAIYGGTYM LNKPIEEIIV QNGKVVGVKS EGEIARCKQL ICDPSYVKDR VEKVGQVIRV ICILSHPIKN TNDANSCQII IPQNQVNRKS DIYVCMISFA HNVAAQGKYI AIVSTTVETK EPEKEIRPAL ELLEPIEQKF VSISDLFVPK DLGTDSQIFI SRAYDATTHF ETTCDDIKDI YKRMTGSEFD FEEMKRKKND IYGED. It is sometimes possible for the material contained within the vial of "Rab GDP dissociation inhibitor beta (Gdi2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.