Probable ribosomal RNA small subunit methyltransferase mra1 (mra1) Recombinant Protein | mra1 recombinant protein
Recombinant Schizosaccharomyces pombe Probable ribosomal RNA small subunit methyltransferase mra1 (mra1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ribosomal RNA small subunit methyltransferase mra1 (mra1); Recombinant Schizosaccharomyces pombe Probable ribosomal RNA small subunit methyltransferase mra1 (mra1); mra1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-359, Full length
Sequence
MPTYSKRKSRGSLEVSEKTNQPKFIKRSQSSETITSGETASELMQDEKEQSNGAVGSIEDEELQRLRENQASVEALSKKPESIDRELGVEALEIDNVVKSDEEKEDPNGASSKTVKARPLPAGSVHRVTTHMAPIPARSIGSHDTTTQRLIVVLDQACLEIYKVGKAKDAKYQLLNCDDHQGILKKLNRNIAQARPDITHQCLLTLLDSPLNKAGRLQVYIHTAKKVLIEVNPSVRIPRTFKRFSGLMVQLLHKLSIRSVNGNEKLLKVIKNPVTDYLPPNCRKATLSFDAPTVPPRKYLETLQPNQSVCIAIGAMAHGPDDFSDGWVDEKISISDYPLSASIACSKFLHSMEDFLGIV
Sequence Length
359
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,775 Da
NCBI Official Full Name
ribosome biogenesis protein Mra1
NCBI Official Symbol
mra1
NCBI Protein Information
ribosome biogenesis protein Mra1
UniProt Protein Name
Ribosomal RNA small subunit methyltransferase mra1
Protein Family
UniProt Gene Name
mra1
Uniprot Description
S-adenosyl-L-methionine-dependent pseudouridine N1-methyltransferase that methylates the pseudouridine corresponding to position 1189 (Psi1189) in S.cerevisiae 18S rRNA. Involved the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA. Has also an essential role in 40S ribosomal subunit biogenesis independent on its methyltransferase activity, facilitating the incorporation of ribosomal protein S19 during the formation of pre-ribosomes (). Essential for cell growth. It also has a key role in promoting the mating function (PubMed:9133664).
Similar Products
Product Notes
The mra1 mra1 (Catalog #AAA1359016) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-359, Full length. The amino acid sequence is listed below: MPTYSKRKSR GSLEVSEKTN QPKFIKRSQS SETITSGETA SELMQDEKEQ SNGAVGSIED EELQRLRENQ ASVEALSKKP ESIDRELGVE ALEIDNVVKS DEEKEDPNGA SSKTVKARPL PAGSVHRVTT HMAPIPARSI GSHDTTTQRL IVVLDQACLE IYKVGKAKDA KYQLLNCDDH QGILKKLNRN IAQARPDITH QCLLTLLDSP LNKAGRLQVY IHTAKKVLIE VNPSVRIPRT FKRFSGLMVQ LLHKLSIRSV NGNEKLLKVI KNPVTDYLPP NCRKATLSFD APTVPPRKYL ETLQPNQSVC IAIGAMAHGP DDFSDGWVDE KISISDYPLS ASIACSKFLH SMEDFLGIV. It is sometimes possible for the material contained within the vial of "Probable ribosomal RNA small subunit methyltransferase mra1 (mra1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
