Thioredoxin domain-containing protein 5 (Txndc5) Recombinant Protein | Txndc5 recombinant protein
Recombinant Mouse Thioredoxin domain-containing protein 5 (Txndc5)
Gene Names
Txndc5; ERp46; PC-TRP; AL022641
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thioredoxin domain-containing protein 5 (Txndc5); Recombinant Mouse Thioredoxin domain-containing protein 5 (Txndc5); Txndc5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-417, full length protein
Sequence
QEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL
Sequence Length
384
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Txndc5 recombinant protein
This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,415 Da
NCBI Official Full Name
thioredoxin domain-containing protein 5 isoform 2
NCBI Official Synonym Full Names
thioredoxin domain containing 5
NCBI Official Symbol
Txndc5
NCBI Official Synonym Symbols
ERp46; PC-TRP; AL022641
NCBI Protein Information
thioredoxin domain-containing protein 5
UniProt Protein Name
Thioredoxin domain-containing protein 5
Protein Family
UniProt Gene Name
Txndc5
UniProt Synonym Gene Names
Tlp46; ER protein 46; ERp46; PC-TRP
Uniprot Description
Possesses thioredoxin activity. Has been shown to reduce insulin disulfide bonds. Also complements protein disulfide-isomerase deficiency in yeast.
Research Articles on Txndc5
Similar Products
Product Notes
The Txndc5 txndc5 (Catalog #AAA1353337) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-417, full length protein. The amino acid sequence is listed below: QEVEADSGVE QDPHAKHLYT ADMFTHGIQS AAHFVMFFAP WCGHCQRLQP TWNDLGDKYN SMEDAKVYVA KVDCTADSDV CSAQGVRGYP TLKFFKPGQE AVKYQGPRDF ETLENWMLQT LNEEPATPEP EAEPPRAPEL KQGLYELSAN NFELHVSQGN HFIKFFAPWC GHCKALAPTW EQLALGLEHS ETVKIGKVDC TQHYAVCSEH QVRGYPTLLW FRDGKKVDQY KGKRDLESLR DYVQSQLQGS EAAPETVEPS EAPVMAAEPT GDKGTVLALT EKSFEDTIAQ GITFVKFYAP WCGHCKNLAP TWEELSKKEF PGLSDVTIAE VDCTAERNVC SKYSVRGYPT LLLFRGGEKV GEHNGGRDLD SLHSFVLRQA KDEL. It is sometimes possible for the material contained within the vial of "Thioredoxin domain-containing protein 5 (Txndc5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
