Protein XRP2 (RP2) Recombinant Protein | RP2 recombinant protein
Recombinant Chicken Protein XRP2 (RP2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein XRP2 (RP2); Recombinant Chicken Protein XRP2 (RP2); RP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-357, Full length protein
Sequence
GCFFSKRRKPAQGGQQQGASQEPAAGEEKAPQYSWDQRAKVDPKDYTFSGLKDETVGRLPGRVAGQQFVIQDCENCSIYIFDHSATVTIDDCVNCQIFLGPIKGSVFFRNCKDCKCIVACQQFRTRDCRRLEVFLCCATQPIIESSTGMKFGCFQYYYPELALQFKDAGLSIFNNTWSNIHDFTPVSGENNWGLLPENAVVQDYVPLPASEELKAVRVSTDAMKSIIPITRGQRQKNSDESCLAVFFAGDYTTANARKLIDEMTGKGFQLVQTKEVSMKAEDAQRVFQQCASEFIPLLERGPVVALEFNGDGAVEGCRNTVNDVFNGTKVFVSESKASASQDVDNFYNFADMQMGM
Sequence Length
356
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RP2 recombinant protein
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,723 Da
NCBI Official Full Name
protein XRP2
NCBI Official Synonym Full Names
retinitis pigmentosa 2 (X-linked recessive)
NCBI Official Symbol
RP2
NCBI Protein Information
protein XRP2
UniProt Protein Name
Protein XRP2
Protein Family
UniProt Gene Name
RP2
Uniprot Description
Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as a GTPase-activating protein. May act as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins ().
Research Articles on RP2
Similar Products
Product Notes
The RP2 rp2 (Catalog #AAA1351732) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-357, Full length protein. The amino acid sequence is listed below: GCFFSKRRKP AQGGQQQGAS QEPAAGEEKA PQYSWDQRAK VDPKDYTFSG LKDETVGRLP GRVAGQQFVI QDCENCSIYI FDHSATVTID DCVNCQIFLG PIKGSVFFRN CKDCKCIVAC QQFRTRDCRR LEVFLCCATQ PIIESSTGMK FGCFQYYYPE LALQFKDAGL SIFNNTWSNI HDFTPVSGEN NWGLLPENAV VQDYVPLPAS EELKAVRVST DAMKSIIPIT RGQRQKNSDE SCLAVFFAGD YTTANARKLI DEMTGKGFQL VQTKEVSMKA EDAQRVFQQC ASEFIPLLER GPVVALEFNG DGAVEGCRNT VNDVFNGTKV FVSESKASAS QDVDNFYNFA DMQMGM. It is sometimes possible for the material contained within the vial of "Protein XRP2 (RP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
