SDS-PAGE
Annexin A8-like protein 2 (ANXA8L2) Recombinant Protein | ANXA8L2 recombinant protein
Recombinant Human Annexin A8-like protein 2 (ANXA8L2)
Gene Names
ANXA8L1; ANXA8; ANXA8L2; VAC-beta; bA145E20.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Annexin A8-like protein 2 (ANXA8L2); Recombinant Human Annexin A8-like protein 2 (ANXA8L2); Annexin A8-like protein 2; ANXA8L2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-276aa; Full Length of Isoform 2
Sequence
MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
Sequence Length
327
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Product Categories/Family for ANXA8L2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57.7 kDa
NCBI Official Full Name
annexin A8-like protein 1 isoform 1
NCBI Official Synonym Full Names
annexin A8-like 1
NCBI Official Symbol
ANXA8L1
NCBI Official Synonym Symbols
ANXA8; ANXA8L2; VAC-beta; bA145E20.2
NCBI Protein Information
annexin A8-like protein 1; annexin-8; annexin A8L2; annexin VIII; annexin A8-like protein 2; vascular anticoagulant-beta
UniProt Protein Name
Annexin A8-like protein 2
UniProt Gene Name
ANXA8L2
UniProt Entry Name
AXA82_HUMAN
NCBI Description
This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. [provided by RefSeq, Apr 2014]
Uniprot Description
ANXA8L1: Belongs to the annexin family.
Chromosomal Location of Human Ortholog: 10q11.22
Molecular Function: calcium-dependent phospholipid binding; calcium ion binding
Research Articles on ANXA8L2
Similar Products
Product Notes
The ANXA8L2 anxa8l2 (Catalog #AAA1349134) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-276aa; Full Length of Isoform 2. The amino acid sequence is listed below: MAWWKAWIEQ EGVTVKSSSH FNPDPDAETL YKAMKGIGVG SQLLSHQAAA FAFPSSALTS VSPWGQQGHL CCNPAGTNEQ AIIDVLTKRS NTQRQQIAKS FKAQFGKDLT ETLKSELSGK FERLIVALMY PPYRYEAKEL HDAMKGSRDD VSSFVDPALA LQDAQDLYAA GEKIRGTDEM KFITILCTRS ATHLLRVKCT QNLHSYFAER LYYAMKGAGT RDGTLIRNIV SRSEIDLNLI KCHFKKMYGK TLSSMIMEDT SGDYKNALLS LVGSDP. It is sometimes possible for the material contained within the vial of "Annexin A8-like protein 2 (ANXA8L2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
