Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc finger protein ZAT12 (ZAT12) Recombinant Protein | ZAT12 recombinant protein

Recombinant Arabidopsis thaliana Zinc finger protein ZAT12 (ZAT12)

Gene Names
RHL41; AtZAT12; MMN10.11; MMN10_11; RESPONSIVE TO HIGH LIGHT 41; ZAT12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein ZAT12 (ZAT12); Recombinant Arabidopsis thaliana Zinc finger protein ZAT12 (ZAT12); ZAT12 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-162, Full length protein
Sequence
MVAISEIKSTVDVTAANCLMLLSRVGQENVDGGDQKRVFTCKTCLKQFHSFQALGGHRASHKKPNNDALSSGLMKKVKTSSHPCPICGVEFPMGQALGGHMRRHRNESGAAGGALVTRALLPEPTVTTLKKSSSGKRVACLDLSLGMVDNLNLKLELGRTVY
Sequence Length
162
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,332 Da
NCBI Official Full Name
C2H2-type zinc finger family protein
NCBI Official Symbol
RHL41
NCBI Official Synonym Symbols
AtZAT12; MMN10.11; MMN10_11; RESPONSIVE TO HIGH LIGHT 41; ZAT12
NCBI Protein Information
C2H2-type zinc finger family protein
UniProt Protein Name
Zinc finger protein ZAT12
Protein Family
UniProt Gene Name
ZAT12
UniProt Synonym Gene Names
RHL41

NCBI Description

Encodes a zinc finger protein involved in high light and cold acclimation. Overexpression of this putative transcription factor increases the expression level of 9 cold-responsive genes and represses the expression level of 15 cold-responsive genes, including CBF genes. Also, lines overexpressing this gene exhibits a small but reproducible increase in freeze tolerance. Because of the repression of the CBF genes by the overexpression of this gene, the authors speculate that this gene may be involved in negative regulatory circuit of the CBF pathway.

Uniprot Description

Transcriptional repressor involved in light acclimation, cold and oxidative stress responses. May regulate a collection of transcripts involved in response to high-light, cold and oxidative stress.

Research Articles on ZAT12

Similar Products

Product Notes

The ZAT12 zat12 (Catalog #AAA1347679) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-162, Full length protein. The amino acid sequence is listed below: MVAISEIKST VDVTAANCLM LLSRVGQENV DGGDQKRVFT CKTCLKQFHS FQALGGHRAS HKKPNNDALS SGLMKKVKTS SHPCPICGVE FPMGQALGGH MRRHRNESGA AGGALVTRAL LPEPTVTTLK KSSSGKRVAC LDLSLGMVDN LNLKLELGRT VY. It is sometimes possible for the material contained within the vial of "Zinc finger protein ZAT12 (ZAT12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.