Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Retinoic acid receptor responder protein 2 (RARRES2) Recombinant Protein | RARRES2 recombinant protein

Recombinant Cricetulus griseus Retinoic acid receptor responder protein 2 (RARRES2)

Gene Names
Rarres2; TIG2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retinoic acid receptor responder protein 2 (RARRES2); Recombinant Cricetulus griseus Retinoic acid receptor responder protein 2 (RARRES2); RARRES2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-163, full length protein
Sequence
TELELSETQRRGLQVALEEFHKHPPVQWAFQEIGVDNANDMVFSAGTFVRLEFKLQQTSCFKKDWKNPECKIKANGRKRKCLACIKLDPRGKVLGRMVHCPILKQGLQQELQESQCNRITQAGEDPRSHFFPGQFAFSRALKHK
Sequence Length
144
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,707 Da
NCBI Official Full Name
retinoic acid receptor responder protein 2
NCBI Official Symbol
Rarres2
NCBI Official Synonym Symbols
TIG2
NCBI Protein Information
retinoic acid receptor responder protein 2
UniProt Protein Name
Retinoic acid receptor responder protein 2
UniProt Gene Name
RARRES2
UniProt Synonym Gene Names
TIG2

Uniprot Description

Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chemotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Its dual role in inflammation and metabolism might provide a link Exhibits an antimicrobial function in the skin ().

Similar Products

Product Notes

The RARRES2 rarres2 (Catalog #AAA1344247) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-163, full length protein. The amino acid sequence is listed below: TELELSETQR RGLQVALEEF HKHPPVQWAF QEIGVDNAND MVFSAGTFVR LEFKLQQTSC FKKDWKNPEC KIKANGRKRK CLACIKLDPR GKVLGRMVHC PILKQGLQQE LQESQCNRIT QAGEDPRSHF FPGQFAFSRA LKHK. It is sometimes possible for the material contained within the vial of "Retinoic acid receptor responder protein 2 (RARRES2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.