Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Osteoclast-associated immunoglobulin-like receptor (OSCAR) Recombinant Protein | OSCAR recombinant protein

Recombinant Human Osteoclast-associated immunoglobulin-like receptor (OSCAR)

Gene Names
OSCAR; PIGR3; PIgR-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Osteoclast-associated immunoglobulin-like receptor (OSCAR); Recombinant Human Osteoclast-associated immunoglobulin-like receptor (OSCAR); OSCAR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-282, Full length protein
Sequence
DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV
Sequence Length
264
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for OSCAR recombinant protein
Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,629 Da
NCBI Official Full Name
osteoclast-associated immunoglobulin-like receptor isoform 6
NCBI Official Synonym Full Names
osteoclast associated, immunoglobulin-like receptor
NCBI Official Symbol
OSCAR
NCBI Official Synonym Symbols
PIGR3; PIgR-3
NCBI Protein Information
osteoclast-associated immunoglobulin-like receptor
UniProt Protein Name
Osteoclast-associated immunoglobulin-like receptor
UniProt Gene Name
OSCAR
UniProt Synonym Gene Names
Osteoclast-associated receptor; hOSCAR; PIgR-3; PIgR3; Poly-Ig receptor 3

NCBI Description

Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation.

Research Articles on OSCAR

Similar Products

Product Notes

The OSCAR oscar (Catalog #AAA1340901) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-282, Full length protein. The amino acid sequence is listed below: DITPSVPPAS YHPKPWLGAQ PATVVTPGVN VTLRCRAPQP AWRFGLFKPG EIAPLLFRDV SSELAEFFLE EVTPAQGGIY RCCYRRPDWG PGVWSQPSDV LELLVTEELP RPSLVALPGP VVGPGANVSL RCAGRLRNMS FVLYREGVAA PLQYRHSAQP WADFTLLGAR APGTYSCYYH TPSAPYVLSQ RSEVLVISWE GEGPEARPAS SAPGMQAPGP PPSDPGAQAP SLSSFRPRGL VLQPLLPQTQ DSWDPAPPPS DPGV. It is sometimes possible for the material contained within the vial of "Osteoclast-associated immunoglobulin-like receptor (OSCAR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.