DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (POLR2M) Recombinant Protein | POLR2M recombinant protein
Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (POLR2M)
Gene Names
POLR2M; GCOM1; Gdown; Gdown1; GRINL1A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerase II subunit GRINL1A; isoforms 4/5 (POLR2M); Recombinant Human DNA-directed RNA polymerase II subunit GRINL1A; POLR2M recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-148, Full length protein
Sequence
MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFGGAAGNVEAPGETFAQRVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVLRASGRRACCGRAVPLPGQKIHLQIARQR
Sequence Length
148
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for POLR2M recombinant protein
This gene (GRINL1A) is part of a complex transcript unit that includes the gene for GRINL1A combined protein (Gcom1). Transcription of this gene occurs at a downstream promoter, with at least three different alternatively spliced variants, grouped together as Gdown for GRINL1A downstream transcripts. The Gcom1 gene uses an upstream promoter for transcription and also has multiple alternatively spliced variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,046 Da
NCBI Official Full Name
protein GRINL1A isoform 2
NCBI Official Synonym Full Names
RNA polymerase II subunit M
NCBI Official Symbol
POLR2M
NCBI Official Synonym Symbols
GCOM1; Gdown; Gdown1; GRINL1A
NCBI Protein Information
protein GRINL1A
UniProt Protein Name
DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5
Protein Family
UniProt Gene Name
POLR2M
UniProt Synonym Gene Names
GRINL1A
NCBI Description
This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 4. Readthrough transcription between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein) is represented with GeneID 145781. [provided by RefSeq, Oct 2013]
Uniprot Description
MiscellaneousThe adjacent MYZAP and POLR2M genes are part of a complex transcription unit. The respective transcripts derive from different promoters and are alternatively spliced. In human, some transcripts of the upstream promoter of MYZAP use exons of the downstream POLR2M gene.
Research Articles on POLR2M
Similar Products
Product Notes
The POLR2M polr2m (Catalog #AAA1338920) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-148, Full length protein. The amino acid sequence is listed below: MATPARAPES PPSADPALVA GPAEEAECPP PRQPQPAQNV LAAPRLRAPS SRGLGAAEFG GAAGNVEAPG ETFAQRVSWG PAESPPGSFS SSSLGAPLPS RTLFPSLEGD FDSVTFASVL RASGRRACCG RAVPLPGQKI HLQIARQR. It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (POLR2M), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
