Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable UDP-arabinopyranose mutase 4 (RGP4) Recombinant Protein | RGP4 recombinant protein

Recombinant Arabidopsis thaliana Probable UDP-arabinopyranose mutase 4 (RGP4)

Gene Names
RGP4; MFB16.25; MFB16_25; reversibly glycosylated polypeptide 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable UDP-arabinopyranose mutase 4 (RGP4); Recombinant Arabidopsis thaliana Probable UDP-arabinopyranose mutase 4 (RGP4); RGP4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-364, Full length protein
Sequence
MAGYNLEAIEAAPLKDDLDIVIPTIRSLDFLEQWRPFLHHYHLIIVQDGDPSIKIRVPEGYDYELYNRNDINRILGPRANCISYKDGGCRCFGFMVSKKKYIYTIDDDCFVAKDPSGKDINVIAQHIKNLETPSTPHYFNTLYDPFRDGTDFVRGYPFSLREGVQTAISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKRVLYPMCGMNLAFNRELVGPAMYFGLMGEGQPISRYDDMWAGWAAKVVCDHLGFGVKTGLPYLWHSKASNPFVNLKKEHKGLHWQEDMVPFFQNLRLSKESDTAAKCYMEISNMTKEKLTKVDPYFEKLADAMVVWIEAWEELNPPVKKKQSDGKDVKAK
Sequence Length
364
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,866 Da
NCBI Official Full Name
reversibly glycosylated polypeptide 4
NCBI Official Symbol
RGP4
NCBI Official Synonym Symbols
MFB16.25; MFB16_25; reversibly glycosylated polypeptide 4
NCBI Protein Information
reversibly glycosylated polypeptide 4
UniProt Protein Name
Probable UDP-arabinopyranose mutase 4
UniProt Gene Name
RGP4
UniProt Synonym Gene Names
AtRGP4

NCBI Description

RGP4 is a reversibly glycosylated polypeptide. Analyses using tagged RGP4 suggest that it is present in the cytosol and in association with the Golgi apparatus. Recombinant RGP4 does not have UDP-arabinose mutase activity based on an in vitro assay even though the related RGP1, RGP2, and RGP3 proteins do have activity in the same assay. RGP4 can form complexes with RGP1 and RGP2. RGP4 is expressed during seed development.

Uniprot Description

Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.

Similar Products

Product Notes

The RGP4 rgp4 (Catalog #AAA1336592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364, Full length protein. The amino acid sequence is listed below: MAGYNLEAIE AAPLKDDLDI VIPTIRSLDF LEQWRPFLHH YHLIIVQDGD PSIKIRVPEG YDYELYNRND INRILGPRAN CISYKDGGCR CFGFMVSKKK YIYTIDDDCF VAKDPSGKDI NVIAQHIKNL ETPSTPHYFN TLYDPFRDGT DFVRGYPFSL REGVQTAISH GLWLNIPDYD APTQLVKPRE RNTRYVDAVM TIPKRVLYPM CGMNLAFNRE LVGPAMYFGL MGEGQPISRY DDMWAGWAAK VVCDHLGFGV KTGLPYLWHS KASNPFVNLK KEHKGLHWQE DMVPFFQNLR LSKESDTAAK CYMEISNMTK EKLTKVDPYF EKLADAMVVW IEAWEELNPP VKKKQSDGKD VKAK. It is sometimes possible for the material contained within the vial of "Probable UDP-arabinopyranose mutase 4 (RGP4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.