Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Ephrin-B1 antibody (MBS839890) used at 1 ug/ml to detect target protein.)

Rabbit Ephrin-B1 Polyclonal Antibody | anti-EFNB1 antibody

Ephrin-B1 antibody

Gene Names
EFNB1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Ephrin-B1; Polyclonal Antibody; Ephrin-B1 antibody; Polyclonal Ephrin-B1; Anti-Ephrin-B1; LERK2; MGC8782; CFNS; Elk-L; CFND; EPLG2; EFNB1; EFL3; anti-EFNB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Ephrin-B1 antibody was raised against the middle region of EFNB1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFNB1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
346
Applicable Applications for anti-EFNB1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Cross-Reactivity
Human, Mouse
Immunogen
Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Ephrin-B1 antibody (MBS839890) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Ephrin-B1 antibody (MBS839890) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-EFNB1 antibody
Rabbit polyclonal Ephrin-B1 antibody raised against the middle region of EFNB1
Product Categories/Family for anti-EFNB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
ephrin-B1
NCBI Official Synonym Full Names
ephrin-B1
NCBI Official Symbol
EFNB1
NCBI Official Synonym Symbols
CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
NCBI Protein Information
ephrin-B1
UniProt Protein Name
Ephrin-B1
Protein Family
UniProt Gene Name
EFNB1
UniProt Synonym Gene Names
EFL3; EPLG2; LERK2; ELK-L; LERK-2
UniProt Entry Name
EFNB1_HUMAN

NCBI Description

The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNB1: a type I membrane protein of the ephrin family. A ligand of Eph-related receptor tyrosine kinases EphB1 and EphA1. Ephrins and ephrin receptors mediate numerous developmental processes, particularly in the nervous system. Ephrin-B1 may play a role in cell adhesion and functions in the development or maintenance of the nervous system. Binding to its receptor induces the collapse of commissural axons/growth cones in vitro. Induced by TNF-alpha. Expressed in brain, heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: Xq12

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; synapse; nucleus; lipid raft

Molecular Function: protein binding; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; positive regulation of T cell proliferation; embryonic pattern specification; cell adhesion; neural crest cell migration

Disease: Craniofrontonasal Syndrome

Research Articles on EFNB1

Similar Products

Product Notes

The EFNB1 efnb1 (Catalog #AAA839890) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ephrin-B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the EFNB1 efnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ephrin-B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.