Histone-lysine N-methyltransferase EHMT1 (Ehmt1) Recombinant Protein | Ehmt1 recombinant protein
Recombinant Mouse Histone-lysine N-methyltransferase EHMT1 (Ehmt1) , partial
Gene Names
Ehmt1; GLP; GLP1; KMT1D; mKIAA1876; D330003E03; Eu-HMTase1; 9230102N17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase EHMT1 (Ehmt1); Recombinant Mouse Histone-lysine N-methyltransferase EHMT1 (Ehmt1); partial; Ehmt1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
134-234. Partial.
Sequence
QGQPLRTPNILTSSLPGHAAKTLPGGASKCRTLSALPQTPTTAPTVPGEGSADTEDRKPTASGTDVRVHRARKTMPKSILGLHAASKDHREVQDHKEPKED
Sequence Length
234
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ehmt1 recombinant protein
This protein is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0
G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene.
G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
136,631 Da
NCBI Official Full Name
histone-lysine N-methyltransferase EHMT1 isoform 1
NCBI Official Synonym Full Names
euchromatic histone methyltransferase 1
NCBI Official Symbol
Ehmt1
NCBI Official Synonym Symbols
GLP; GLP1; KMT1D; mKIAA1876; D330003E03; Eu-HMTase1; 9230102N17Rik
NCBI Protein Information
histone-lysine N-methyltransferase EHMT1
UniProt Protein Name
Histone-lysine N-methyltransferase EHMT1
Protein Family
UniProt Gene Name
Ehmt1
UniProt Synonym Gene Names
Euhmtase1; Glp; Kmt1d; Eu-HMTase1; GLP; GLP1
Uniprot Description
Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in G0/G1 transition in cell cycle. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53.
Research Articles on Ehmt1
Similar Products
Product Notes
The Ehmt1 ehmt1 (Catalog #AAA1332873) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 134-234. Partial. The amino acid sequence is listed below: QGQPLRTPNI LTSSLPGHAA KTLPGGASKC RTLSALPQTP TTAPTVPGEG SADTEDRKPT ASGTDVRVHR ARKTMPKSIL GLHAASKDHR EVQDHKEPKE D . It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase EHMT1 (Ehmt1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
