Dual specificity mitogen-activated protein kinase kinase 1 (MAP2K1) Recombinant Protein | MAP2K1 recombinant protein

Recombinant Cricetulus griseus Dual specificity mitogen-activated protein kinase kinase 1 (MAP2K1)

Cat. Num. AAA1331440

• Gene Names: Map2k1; MEK1; Mapkk; PRKMK1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dual specificity mitogen-activated protein kinase kinase 1 (MAP2K1); Recombinant Cricetulus griseus Dual specificity mitogen-activated protein kinase kinase 1 (MAP2K1); MAP2K1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-393, full length protein
• Sequence: PKKKPTPIQLNPTPDGSAVNGTSSAETNLEALQKKLEELELEEQQRNRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGVFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPAKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLLVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
• Sequence Length: 392

• Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 350540082
• NCBI GeneID: 100689403
• NCBI Accession #: NP_001233756.1
• NCBI GenBank Nucleotide #: NM_001246827.1
• UniProt Accession #: Q63980
• Molecular Weight: 43,479 Da
• NCBI Official Full Name: dual specificity mitogen-activated protein kinase kinase 1
• NCBI Official Symbol: Map2k1
• NCBI Official Synonym Symbols: MEK1; Mapkk; PRKMK1
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 1
• UniProt Protein Name: Dual specificity mitogen-activated protein kinase kinase 1
• UniProt Gene Name: MAP2K1
• UniProt Synonym Gene Names: MEK1; PRKMK1; MAP kinase kinase 1; MAPKK 1; MEK 1

Uniprot Description

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Binding of extracellular ligands such as growth factors, cytokines and hormones to their cell-surface receptors activates RAS and this initiates RAF1 activation. RAF1 then further activates the dual-specificity protein kinases MAP2K1/MEK1 and MAP2K2/MEK2. Both MAP2K1/MEK1 and MAP2K2/MEK2 function specifically in the MAPK/ERK cascade, and catalyze the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in the extracellular signal-regulated kinases MAPK3/ERK1 and MAPK1/ERK2, leading to their activation and further transduction of the signal within the MAPK/ERK cascade. Depending on the cellular context, this pathway mediates diverse biological functions such as cell growth, adhesion, survival and differentiation, predominantly through the regulation of transcription, metabolism and cytoskeletal rearrangements. One target of the MAPK/ERK cascade is peroxisome proliferator-activated receptor gamma (PPARG), a nuclear receptor that promotes differentiation and apoptosis. MAP2K1/MEK1 has been shown to export PPARG from the nucleus. The MAPK/ERK cascade is also involved in the regulation of endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC), as well as in the fragmentation of the Golgi apparatus during mitosis ().