Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alginate biosynthesis protein AlgX (algX) Recombinant Protein | algX recombinant protein

Recombinant Pseudomonas aeruginosa Alginate biosynthesis protein AlgX (algX)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alginate biosynthesis protein AlgX (algX); Recombinant Pseudomonas aeruginosa Alginate biosynthesis protein AlgX (algX); algX recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-474, Full length protein
Sequence
ADPGAAPSYQALPAGNLCPAAAYDSRYNTKYLGFFTHLVQAQDDWLFRTTYDLRTDFGTSAEGWRELRALRDELKRKGIELVVVYQPTRGLVNREKLSPAEKAGFDYELAKKNYLATIARFRQAGIWTPDFSPLFDEKEEHAYYFKGDHHWTPHGARRSAKIVAETLKQVPGFEEIPKKQFESKRVGLLSKLGTFHKAAAQLCGNSYATQYVDRFETEPVGASDSGDLFGDGGNPQIALVGTSNSGPAYNFAGFLEEFSGADILNNAVSGGGFDSSLLAYMTSEEFHKNPPKILIWEFATHYDMAQKSFYRQAMPLVDNGCSGRKTVLSRKVKLRQGRNEVLLNSAALPIRSGSYVADVTYSDPSVHELKNTIWYMNGRREQLKIEQSKAVDTGGRYVFQLRNDSDWADQQFLSLEIEAPEDMPQGLEVQASICQAAPAKASQSVAGR
Sequence Length
448
Species
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,596 Da
NCBI Official Full Name
alginate biosynthesis protein AlgX
NCBI Official Symbol
algX
NCBI Protein Information
alginate biosynthesis protein AlgX
UniProt Protein Name
Alginate biosynthesis protein AlgX
UniProt Gene Name
algX

Uniprot Description

Plays two roles in the biosynthesis of the exopolysaccharide alginate: protects alginate from degradation as the polymer traverses the periplasm, and also plays a role in its O-acetylation. Acetylation of alginate causes the cells in the biofilm to adhere better to lung epithelium, form microcolonies, and resist the effects of the host immune system and/or antibiotics. Displays a low acetylesterase activity in vitro using a pseudosubstrate, 3-carboxyumbelliferyl acetate. Probably has acetyltransferase activity in vivo.

Research Articles on algX

Similar Products

Product Notes

The algX algx (Catalog #AAA1326757) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-474, Full length protein. The amino acid sequence is listed below: ADPGAAPSYQ ALPAGNLCPA AAYDSRYNTK YLGFFTHLVQ AQDDWLFRTT YDLRTDFGTS AEGWRELRAL RDELKRKGIE LVVVYQPTRG LVNREKLSPA EKAGFDYELA KKNYLATIAR FRQAGIWTPD FSPLFDEKEE HAYYFKGDHH WTPHGARRSA KIVAETLKQV PGFEEIPKKQ FESKRVGLLS KLGTFHKAAA QLCGNSYATQ YVDRFETEPV GASDSGDLFG DGGNPQIALV GTSNSGPAYN FAGFLEEFSG ADILNNAVSG GGFDSSLLAY MTSEEFHKNP PKILIWEFAT HYDMAQKSFY RQAMPLVDNG CSGRKTVLSR KVKLRQGRNE VLLNSAALPI RSGSYVADVT YSDPSVHELK NTIWYMNGRR EQLKIEQSKA VDTGGRYVFQ LRNDSDWADQ QFLSLEIEAP EDMPQGLEVQ ASICQAAPAK ASQSVAGR. It is sometimes possible for the material contained within the vial of "Alginate biosynthesis protein AlgX (algX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.