Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium and integrin-binding family member 3 (CIB3) Recombinant Protein | CIB3 recombinant protein

Recombinant Human Calcium and integrin-binding family member 3 (CIB3)

Gene Names
CIB3; KIP3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium and integrin-binding family member 3 (CIB3); Recombinant Human Calcium and integrin-binding family member 3 (CIB3); CIB3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-187, Full length protein
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFLSTFHIRI
Sequence Length
187
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CIB3 recombinant protein
This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,974 Da
NCBI Official Full Name
calcium and integrin-binding family member 3 isoform 2
NCBI Official Synonym Full Names
calcium and integrin binding family member 3
NCBI Official Symbol
CIB3
NCBI Official Synonym Symbols
KIP3
NCBI Protein Information
calcium and integrin-binding family member 3
UniProt Protein Name
Calcium and integrin-binding family member 3
UniProt Gene Name
CIB3
UniProt Synonym Gene Names
KIP3; KIP 3

NCBI Description

This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

MiscellaneousThe binding of either calcium or magnesium significantly increases the structural stability of the protein in comparison to apo-CIB (calcium- and magnesium-free form).

Research Articles on CIB3

Similar Products

Product Notes

The CIB3 cib3 (Catalog #AAA1325330) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-187, Full length protein. The amino acid sequence is listed below: MGNKQTVFTH EQLEAYQDCT FFTRKEIMRL FYRYQDLAPQ LVPLDYTTCP DVKVPYELIG SMPELKDNPF RQRIAQVFSE DGDGHMTLDN FLDMFSVMSE MAPRDLKAYY AFKIYDFNND DYICAWDLEQ TVTKLTRGGL SAEEVSLVCE KVLDEADGDH DGRLSLEDFQ NMILRAPDFL STFHIRI. It is sometimes possible for the material contained within the vial of "Calcium and integrin-binding family member 3 (CIB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.