Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Protein deltex-2 (Dtx2) Recombinant Protein | Dtx2 recombinant protein

Recombinant Mouse Protein deltex-2 (Dtx2)

Gene Names
Dtx2; Deltex2; AA408415; AU022494; 2610524D08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein deltex-2 (Dtx2); Recombinant Mouse Protein deltex-2 (Dtx2); Dtx2 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-619, Full length protein
Sequence
MAMAPSSSLPQVYPSHVVVAVWEWQDGLGIWHPYSATVCSFIEQHFVRQRGQHFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQNTGTMRSVRRHLFSQNSAPGQGIVWEWLGDDGSWVAYEARICDYLEQQVARGIQVVDLAPLGYNYTVNYATLTQTNKTSSFCRSVRRQVGPVYPVTSDIAVPRQMGLICFCQQCLHGSGTGPVSGRYRHSMTNLPAYPAPQAPHRTTTVSGAHQAFAPYNKPSLSGARSAPRLNTTNPWAAAPPVAGNQSLFHSSLSHLGPQLLPSGPSTSSGASASFPSGPSSSSPGSAPTTVPVQMPKASRVQQALAGMTSVLSAIGLPVCLSRAPRPTGPPASRPASKSHSSVKRLRKMSVKEGAPKPEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRFQMSLPGHEDCGTILIVYNIPHGIQGPEHPSPGKPFTARGFPRQCYLPDSPQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ
Sequence Length
619
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,720 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase DTX2 isoform 1
NCBI Official Synonym Full Names
deltex 2, E3 ubiquitin ligase
NCBI Official Symbol
Dtx2
NCBI Official Synonym Symbols
Deltex2; AA408415; AU022494; 2610524D08Rik
NCBI Protein Information
probable E3 ubiquitin-protein ligase DTX2
UniProt Protein Name
Probable E3 ubiquitin-protein ligase DTX2
Protein Family
UniProt Gene Name
Dtx2
UniProt Synonym Gene Names
Deltex2; mDTX2

Uniprot Description

Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Functions as a ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity ().

Research Articles on Dtx2

Similar Products

Product Notes

The Dtx2 dtx2 (Catalog #AAA1320620) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-619, Full length protein. The amino acid sequence is listed below: MAMAPSSSLP QVYPSHVVVA VWEWQDGLGI WHPYSATVCS FIEQHFVRQR GQHFGLGSLA HSIPLGQADP SLAPYIIDLP SWTQFRQNTG TMRSVRRHLF SQNSAPGQGI VWEWLGDDGS WVAYEARICD YLEQQVARGI QVVDLAPLGY NYTVNYATLT QTNKTSSFCR SVRRQVGPVY PVTSDIAVPR QMGLICFCQQ CLHGSGTGPV SGRYRHSMTN LPAYPAPQAP HRTTTVSGAH QAFAPYNKPS LSGARSAPRL NTTNPWAAAP PVAGNQSLFH SSLSHLGPQL LPSGPSTSSG ASASFPSGPS SSSPGSAPTT VPVQMPKASR VQQALAGMTS VLSAIGLPVC LSRAPRPTGP PASRPASKSH SSVKRLRKMS VKEGAPKPEP EQVIRKYTEE LKVAPEEDCI ICMEKLAVAS GYSDMTDSKA LGPMVVGRLT KCSHAFHLLC LLAMYCNGNK DGSLQCPSCK TIYGEKTGTQ PWGKMEVFRF QMSLPGHEDC GTILIVYNIP HGIQGPEHPS PGKPFTARGF PRQCYLPDSP QGRKVLELLK VAWKRRLIFT VGTSSTTGET DTVVWNEIHH KTEMDRNVTG HGYPDPNYLQ NVLAELAAQG VTEDCLEQQ. It is sometimes possible for the material contained within the vial of "Protein deltex-2 (Dtx2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual