Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Atrial natriuretic peptide-converting enzyme (CORIN) Recombinant Protein | CORIN recombinant protein

Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN) , partial

Gene Names
CORIN; CRN; ATC2; Lrp4; PEE5; TMPRSS10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Atrial natriuretic peptide-converting enzyme (CORIN); Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN); partial; CORIN recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
802-1042, Fragment at the C-terminal, provide the Atrial natriuretic peptide-converting enzyme, activated protease fragment.
Sequence
ILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLLN
Sequence Length
1042
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CORIN recombinant protein
This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113,297 Da
NCBI Official Full Name
atrial natriuretic peptide-converting enzyme isoform 2
NCBI Official Synonym Full Names
corin, serine peptidase
NCBI Official Symbol
CORIN
NCBI Official Synonym Symbols
CRN; ATC2; Lrp4; PEE5; TMPRSS10
NCBI Protein Information
atrial natriuretic peptide-converting enzyme
UniProt Protein Name
Atrial natriuretic peptide-converting enzyme
UniProt Gene Name
CORIN
UniProt Synonym Gene Names
CRN; TMPRSS10

NCBI Description

This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

Serine-type endopeptidase involved in atrial natriuretic peptide hormone (NPPA) processing. Converts through proteolytic cleavage the non-functional propeptide NPPA into the active hormone, thereby regulating blood pressure in heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney. May also process pro-NPPB the B-type natriuretic peptide.Isoform 2: has weaker endopeptidase activity compared to isoform 1.MiscellaneousInitially named CORIN due to its abundant expression in the heart.

Research Articles on CORIN

Similar Products

Product Notes

The CORIN corin (Catalog #AAA1319963) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 802-1042, Fragment at the C-terminal, provide the Atrial natriuretic peptide-converting enzyme, activated protease fragment. The amino acid sequence is listed below: ILGGRTSRPG RWPWQCSLQS EPSGHICGCV LIAKKWVLTV AHCFEGRENA AVWKVVLGIN NLDHPSVFMQ TRFVKTIILH PRYSRAVVDY DISIVELSED ISETGYVRPV CLPNPEQWLE PDTYCYITGW GHMGNKMPFK LQEGEVRIIS LEHCQSYFDM KTITTRMICA GYESGTVDSC MGDSGGPLVC EKPGGRWTLF GLTSWGSVCF SKVLGPGVYS NVSYFVEWIK RQIYIQTFLL N . It is sometimes possible for the material contained within the vial of "Atrial natriuretic peptide-converting enzyme (CORIN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.