C-C motif chemokine 5 (CCL5) Recombinant Protein | CCL5 recombinant protein
Recombinant Cat C-C motif chemokine 5 (CCL5)
Gene Names
CCL5; RANTES
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 5 (CCL5); Recombinant Cat C-C motif chemokine 5 (CCL5); CCL5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-92, full length protein
Sequence
SPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMPAVVFVTRRKRQVCANPQKKWVRDKGINSLEMN
Sequence Length
69
Species
Felis catus (Cat) (Felis silvestris catus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CCL5 recombinant protein
This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,167 Da
NCBI Official Full Name
C-C motif chemokine 5
NCBI Official Symbol
CCL5
NCBI Official Synonym Symbols
RANTES
NCBI Protein Information
C-C motif chemokine 5
UniProt Protein Name
C-C motif chemokine 5
Protein Family
UniProt Gene Name
CCL5
UniProt Synonym Gene Names
SCYA5
Uniprot Description
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.
Similar Products
Product Notes
The CCL5 ccl5 (Catalog #AAA1316014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-92, full length protein. The amino acid sequence is listed below: SPYASDTTPC CFAYLSHPLP LTHLQEYFYT SSKCSMPAVV FVTRRKRQVC ANPQKKWVRD KGINSLEMN. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 5 (CCL5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
