Leucine-rich repeat-containing protein 51 (LRTOMT) Recombinant Protein | LRTOMT recombinant protein

Recombinant Human Leucine-rich repeat-containing protein 51 (LRTOMT)

Cat. Num. AAA1313494

• Gene Names: LRTOMT; DFNB63; LRRC51; CFAP111
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Leucine-rich repeat-containing protein 51 (LRTOMT); Recombinant Human Leucine-rich repeat-containing protein 51 (LRTOMT); LRTOMT recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-192, Full length protein
• Sequence: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL
• Sequence Length: 192

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 223718151
• NCBI GeneID: 220074
• NCBI Accession #: NP_001138779.1
• NCBI GenBank Nucleotide #: NM_001145307.4
• UniProt Accession #: Q96E66; B2R7X1; B6CZ35; B6CZ36; B6CZ37; B6CZ38; B6CZ39; B7Z5I4; Q8WZ04
• Molecular Weight: 19,974 Da
• NCBI Official Full Name: leucine-rich repeat-containing protein 51 isoform LRTOMT1b
• NCBI Official Synonym Full Names: leucine rich transmembrane and O-methyltransferase domain containing
• NCBI Official Symbol: LRTOMT
• NCBI Official Synonym Symbols: DFNB63; LRRC51; CFAP111
• NCBI Protein Information: transmembrane O-methyltransferase; leucine-rich repeat-containing protein 51
• UniProt Protein Name: Leucine-rich repeat-containing protein 51
• UniProt Gene Name: LRTOMT
• UniProt Synonym Gene Names: LRRC51

NCBI Description

This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centromere-distal 3' terminal exon (long transcript form) encode the LRTOMT2 protein. There is a small region within one of the exons of this gene that contains overlapping alternate reading frames for both LRTOMT1 and LRTOMT2. LRTOMT1 shares similarity with the protein encoded by mouse Lrrc51, while LRTOMT2 shares similarity with the protein encoded by mouse Tomt. Alternative splicing results in multiple transcript variants, encoding different isoforms of both LRTOMT1 and LRTOMT2. The LRTOMT1 protein is a leucine-rich repeat-containing protein, while the LRTOMT2 protein is a catechol-O-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to a hydroxyl group of catechols and is essential for auditory and vestibular function. Mutations in this gene have been associated with nonsyndromic deafness. [provided by RefSeq, Nov 2017]

Uniprot Description

MiscellaneousIn primates, this protein is produced by a bicistronic gene which also produces the TOMT protein from an overlapping reading frame. In rodents, these proteins are produced by 2 separate adjacent genes which together are orthologous to the single primate gene.