Protein FLOWERING LOCUS T (FT) Recombinant Protein | FT recombinant protein

Recombinant Arabidopsis thaliana Protein FLOWERING LOCUS T (FT)

Cat. Num. AAA1310027

• Gene Names: FT; F5I14.3; F5I14_3; FLOWERING LOCUS T; REDUCED STEM BRANCHING 8; RSB8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein FLOWERING LOCUS T (FT); Recombinant Arabidopsis thaliana Protein FLOWERING LOCUS T (FT); FT recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-175aa; Full-Length
• Sequence: MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15218709
• NCBI GeneID: 842859
• NCBI Accession #: NP_176726.1
• NCBI GenBank Nucleotide #: NM_105222.3
• UniProt Accession #: Q9SXZ2; O04467
• Molecular Weight: 13,742 Da
• NCBI Official Full Name: PEBP (phosphatidylethanolamine-binding protein) family protein
• NCBI Official Symbol: FT
• NCBI Official Synonym Symbols: F5I14.3; F5I14_3; FLOWERING LOCUS T; REDUCED STEM BRANCHING 8; RSB8
• NCBI Protein Information: PEBP (phosphatidylethanolamine-binding protein) family protein
• UniProt Protein Name: Protein FLOWERING LOCUS T
• Protein Family: Protein FLOWERING LOCUS
• UniProt Gene Name: FT

NCBI Description

FT, together with LFY, promotes flowering and is antagonistic with its homologous gene, TERMINAL FLOWER1 (TFL1). FT is expressed in leaves and is induced by long day treatment. Either the FT mRNA or protein is translocated to the shoot apex where it induces its own expression. Recent data suggests that FT protein acts as a long-range signal. FT is a target of CO and acts upstream of SOC1.

Uniprot Description

Component of the mobile flower-promoting signal (floral stimulus or florigen). Promotes the transition from vegetative growth to flowering. Required for 'SEPALLATA3' (SEP3) and 'FRUITFULL' (FUL) accumulation in mature rosette leaves. Seems to acts in parallel with 'LEAFY' to induce flowering by regulating 'APETALA1'. Translated in leaves and then transported to the shoot apical meristem where it activates the transcription of several floral meristem identity genes. May play a role in both the autonomous and the long-day flowering pathways.