Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Exosome complex component RRP40 (EXOSC3) Recombinant Protein | EXOSC3 recombinant protein

Recombinant Bovine Exosome complex component RRP40 (EXOSC3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Exosome complex component RRP40 (EXOSC3); Recombinant Bovine Exosome complex component RRP40 (EXOSC3); EXOSC3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-275, full length protein
Sequence
AEAAGVPAESLAGCRARAARTVLDQVVLPGEELLLPDQEDGDGPGGAGERPLRLNAAARSRGRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEILQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTADQRKQIFSRLAES
Sequence Length
274
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,495 Da
NCBI Official Full Name
exosome complex component RRP40
NCBI Official Synonym Full Names
exosome component 3
NCBI Official Symbol
EXOSC3
NCBI Protein Information
exosome complex component RRP40
UniProt Protein Name
Exosome complex component RRP40
Protein Family
UniProt Gene Name
EXOSC3
UniProt Synonym Gene Names
RRP40

Uniprot Description

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of RNase PH-domain subunits through contacts with EXOSC9 and EXOSC5 ().

Similar Products

Product Notes

The EXOSC3 exosc3 (Catalog #AAA1309650) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-275, full length protein. The amino acid sequence is listed below: AEAAGVPAES LAGCRARAAR TVLDQVVLPG EELLLPDQED GDGPGGAGER PLRLNAAARS RGRVVCGPGL RRCGDRLLVT KCGRLRHKEP GSGSGGGVYW VDSQQKRYVP VKGDHVIGIV TAKSGDIFKV DVGGSEPASL SYLAFEGATK RNRPNVQVGD LIYGQFVVAN KDMEPEMVCI DSCGRANGMG VIGQDGLLFK VTLGLIRKLL APDCEILQEV GKLYPLEIVF GMNGRIWVKA KTIQQTLILA NILEACEHMT ADQRKQIFSR LAES. It is sometimes possible for the material contained within the vial of "Exosome complex component RRP40 (EXOSC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.