5' exonuclease Apollo (DCLRE1B) Recombinant Protein | DCLRE1B recombinant protein

Recombinant Human 5' exonuclease Apollo (DCLRE1B)

Cat. Num. AAA1300109

• Gene Names: DCLRE1B; SNM1B; SNMIB; APOLLO
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 5' exonuclease Apollo (DCLRE1B); Recombinant Human 5' exonuclease Apollo (DCLRE1B); DCLRE1B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-532, Full length protein
• Sequence: MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC
• Sequence Length: 532

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 985801685
• NCBI GeneID: 64858
• NCBI Accession #: NP_001306876.1
• NCBI GenBank Nucleotide #: NM_001319947.1
• UniProt Accession #: Q9H816; Q9H9E5
• Molecular Weight: 60,002 Da
• NCBI Official Full Name: 5' exonuclease Apollo isoform b
• NCBI Official Synonym Full Names: DNA cross-link repair 1B
• NCBI Official Symbol: DCLRE1B
• NCBI Official Synonym Symbols: SNM1B; SNMIB; APOLLO
• NCBI Protein Information: 5' exonuclease Apollo
• UniProt Protein Name: 5' exonuclease Apollo
• Protein Family: 5' exonuclease
• UniProt Gene Name: DCLRE1B
• UniProt Synonym Gene Names: SNM1B; SNMIB; hSNM1B

NCBI Description

DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al., 2000 [PubMed 10848582]).[supplied by OMIM, Mar 2008]

Uniprot Description

5'-3' exonuclease that plays a central role in telomere maintenance and protection during S-phase. Participates in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair, thereby ensuring that telomeres do not fuse. Plays a key role in telomeric loop (T loop) formation by being recruited by TERF2 at the leading end telomeres and by processing leading-end telomeres immediately after their replication via its exonuclease activity: generates 3' single-stranded overhang at the leading end telomeres avoiding blunt leading-end telomeres that are vulnerable to end-joining reactions and expose the telomere end in a manner that activates the DNA repair pathways. Together with TERF2, required to protect telomeres from replicative damage during replication by controlling the amount of DNA topoisomerase (TOP1, TOP2A and TOP2B) needed for telomere replication during fork passage and prevent aberrant telomere topology. Also involved in response to DNA damage: plays a role in response to DNA interstrand cross-links (ICLs) by facilitating double-strand break formation. In case of spindle stress, involved in prophase checkpoint.