C-C motif chemokine 4-like (CCL4L1) Recombinant Protein | CCL4L1 recombinant protein

Recombinant Human C-C motif chemokine 4-like (CCL4L1)

Cat. Num. AAA1300084

• Gene Names: CCL4L2; CCL4L; SCYA4L; AT744.2; SCYQ4L2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 4-like (CCL4L1); Recombinant Human C-C motif chemokine 4-like (CCL4L1); CCL4L1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-92, Full length protein
• Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
• Sequence Length: 69

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CCL4L1 recombinant protein

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene.

NCBI and Uniprot Product Information

• NCBI GI #: 612400620
• NCBI GeneID: 9560
• NCBI Accession #: NP_001278397.1
• NCBI GenBank Nucleotide #: NM_001291468.1
• UniProt Accession #: Q8NHW4; Q50EM1; Q50EM2; Q50EM3; Q50EM4; Q50EM5; Q50EM6; Q50EM7; Q50EM8; Q569J2; B2RUZ3; B7ZMA8
• Molecular Weight: 11,008 Da
• NCBI Official Full Name: C-C motif chemokine 4-like isoform 1
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 4 like 2
• NCBI Official Symbol: CCL4L2
• NCBI Official Synonym Symbols: CCL4L; SCYA4L; AT744.2; SCYQ4L2
• NCBI Protein Information: C-C motif chemokine 4-like
• UniProt Protein Name: C-C motif chemokine 4-like
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL4L1
• UniProt Synonym Gene Names: CCL4L; LAG1; SCYA4L1; LAG-1; MIP-1-beta

NCBI Description

This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. This gene copy contains a non-consensus splice acceptor site at the 3' terminal exon found in other highly similar gene copies, and it thus uses other alternative splice sites for the 3' terminal exon, resulting in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.