Keratin, type II cytoskeletal 75 (Krt75) Recombinant Protein | Krt75 recombinant protein
Recombinant Rat Keratin, type II cytoskeletal 75 (Krt75)
Gene Names
Krt75; Kb18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin; type II cytoskeletal 75 (Krt75); Recombinant Rat Keratin; Krt75 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-542, full length protein
Sequence
MSRQSTVTFHSGSRRGFSTASATTPTAGRSRFSSVSVARSSGNSGGLGRISGIGSGFGSRSLYNLGATRPVSVGGCAGSGFRSGFGGRASSSFGYGGGFGGPGFPVCPSGSIQEVTVNQSLLTPLNLQIDPTIQRVRKEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQEQGSRTVRQNLEPFFDAYVNDLRRQLDSVTAERGRLDAELRHMQEVVEDFKVRYEDEINKRAAAENEFVGLKKDVDGAYMNKVELEAKVDSLTDQINFYRMVYEAELSQMQNQVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRSEIDAVKKQCSSLQTAISDTEQRGELALKDARAKLVELEDALQKAKQDMARLLREYQELMNVKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTVSSGYGGGTNIGGGSLGLGGNSGYSFTTTGGHSLGTGLGGSGFTTSSSRGPVGSGSSIKFVSSTSSSRKSYKH
Sequence Length
542
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Krt75 recombinant protein
This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion layer, upper germinative matrix region of the hair follicle, and medulla of the hair shaft. The encoded protein plays an essential role in hair and nail formation. Variations in this gene have been associated with the hair disorders pseudofolliculitis barbae (PFB) and loose anagen hair syndrome (LAHS).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,027 Da
NCBI Official Full Name
keratin, type II cytoskeletal 75
NCBI Official Synonym Full Names
keratin 75
NCBI Official Symbol
Krt75
NCBI Official Synonym Symbols
Kb18
NCBI Protein Information
keratin, type II cytoskeletal 75
UniProt Protein Name
Keratin, type II cytoskeletal 75
Protein Family
UniProt Gene Name
Krt75
UniProt Synonym Gene Names
Kb18; CK-75; K75
Uniprot Description
Plays a central role in hair and nail formation. Essential component of keratin intermediate filaments in the companion layer of the hair follicle ().
Similar Products
Product Notes
The Krt75 krt75 (Catalog #AAA1297284) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-542, full length protein. The amino acid sequence is listed below: MSRQSTVTFH SGSRRGFSTA SATTPTAGRS RFSSVSVARS SGNSGGLGRI SGIGSGFGSR SLYNLGATRP VSVGGCAGSG FRSGFGGRAS SSFGYGGGFG GPGFPVCPSG SIQEVTVNQS LLTPLNLQID PTIQRVRKEE REQIKTLNNK FASFIDKVRF LEQQNKVLET KWNLLQEQGS RTVRQNLEPF FDAYVNDLRR QLDSVTAERG RLDAELRHMQ EVVEDFKVRY EDEINKRAAA ENEFVGLKKD VDGAYMNKVE LEAKVDSLTD QINFYRMVYE AELSQMQNQV SDTSVVLSMD NNRSLDLDSI IAEVKAQYED IANRSRAEAE SWYQTKYEEL QVTAGRHGDD LRNTKQEISE MNRMIQRLRS EIDAVKKQCS SLQTAISDTE QRGELALKDA RAKLVELEDA LQKAKQDMAR LLREYQELMN VKLALDVEIA TYRKLLEGEE CRLSGEGVSP VNISVVTSTV SSGYGGGTNI GGGSLGLGGN SGYSFTTTGG HSLGTGLGGS GFTTSSSRGP VGSGSSIKFV SSTSSSRKSY KH. It is sometimes possible for the material contained within the vial of "Keratin, type II cytoskeletal 75 (Krt75), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
