Protein syndesmos (Nudt16l1) Recombinant Protein | Nudt16l1 recombinant protein
Recombinant Mouse Protein syndesmos (Nudt16l1)
Gene Names
Nudt16l1; Sdos; 1110001K21Rik; 5330437I08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein syndesmos (Nudt16l1); Recombinant Mouse Protein syndesmos (Nudt16l1); Nudt16l1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211, full length protein
Sequence
MSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVLNMMPSEKLAEALASATEKQKKALEKLLPPSS
Sequence Length
211
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,733 Da
NCBI Official Full Name
tudor-interacting repair regulator protein isoform 2
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
NCBI Official Symbol
Nudt16l1
NCBI Official Synonym Symbols
Sdos; 1110001K21Rik; 5330437I08Rik
NCBI Protein Information
tudor-interacting repair regulator protein
UniProt Protein Name
Tudor-interacting repair regulator protein
UniProt Gene Name
Nudt16l1
Uniprot Description
Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin. In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus. Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs). Binds U8 snoRNA.
Similar Products
Product Notes
The Nudt16l1 nudt16l1 (Catalog #AAA1296022) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211, full length protein. The amino acid sequence is listed below: MSTTTVPELK QISREEAMRL GPGWSHSCHA MLYAANPGQL FGRIPMRFSV LMQMRFDGLL GFPGGFVDRR FWSLEDGLNR VLGLGLGGLR LTEADYLSSH LTEGPHRVVA HLYARQLTLE QLHAVEISAV HSRDHGLEVL GLVRVPLYTQ KDRVGGFPNF LSNAFVSTAK YQLLFALKVL NMMPSEKLAE ALASATEKQK KALEKLLPPS S. It is sometimes possible for the material contained within the vial of "Protein syndesmos (Nudt16l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
