Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Malate dehydrogenase, cytoplasmic (MDH1) Recombinant Protein | MDH1 recombinant protein

Recombinant Bovine Malate dehydrogenase, cytoplasmic (MDH1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Malate dehydrogenase; cytoplasmic (MDH1); Recombinant Bovine Malate dehydrogenase; MDH1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-334, full length protein
Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGIPDDLLYSFPVTIKDKTWKVVEGLPINDFSREKMDLTAKELAEEKETAFEFLASA
Sequence Length
333
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MDH1 recombinant protein
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD
NADH cofactor system in the citric acid cycle. This protein is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,438 Da
NCBI Official Full Name
malate dehydrogenase, cytoplasmic isoform MDH1
NCBI Official Synonym Full Names
malate dehydrogenase 1
NCBI Official Symbol
MDH1
NCBI Protein Information
malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
Protein Family
UniProt Gene Name
MDH1

NCBI Description

This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. [provided by RefSeq, Feb 2016]

Similar Products

Product Notes

The MDH1 mdh1 (Catalog #AAA1292311) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-334, full length protein. The amino acid sequence is listed below: SEPIRVLVTG AAGQIAYSLL YSIGNGSVFG KDQPIILVLL DITPMMGVLD GVLMELQDCA LPLLKDVIAT DKEEIAFKDL DVAILVGSMP RRDGMERKDL LKANVKIFKC QGAALDKYAK KSVKVIVVGN PANTNCLTAS KSAPSIPKEN FSCLTRLDHN RAKAQIALKL GVTSDDVKNV IIWGNHSSTQ YPDVNHAKVK LQGKEVGVYE ALKDDSWLKG EFITTVQQRG AAVIKARKLS SAMSAAKAIC DHVRDIWFGT PEGEFVSMGI ISDGNSYGIP DDLLYSFPVT IKDKTWKVVE GLPINDFSRE KMDLTAKELA EEKETAFEFL ASA. It is sometimes possible for the material contained within the vial of "Malate dehydrogenase, cytoplasmic (MDH1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.