A-kinase anchor protein 4 (Akap4) Recombinant Protein | Akap4 recombinant protein
Recombinant Mouse A-kinase anchor protein 4 (Akap4)
Gene Names
Akap4; p82; Fsc1; PRKA4; AKAP-4; AKAP82; mAKAP82
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
A-kinase anchor protein 4 (Akap4); Recombinant Mouse A-kinase anchor protein 4 (Akap4); Akap4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
189-849, Full length protein
Sequence
QSPSNPATKSPSNQRSVATPEGECSMDDLSFYVNRLSSLVIQMARKEIKDKLEGGSKCLHHSMYTSGDKGKTSPRSAVSKIASEMAHEAVELTSSEMRGNGEDCRDGRKTFLYSEMCNKNKCGEKQQMCPKDSKEFADSISKGLMVYANQVASDMMVSVMKTLKVHSCGKPIPACVVLKRVLLKHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNHGKQNAADIMEAMLKRLVSALLGEKKETKSQSLAYATLKAGTNDPKCKNQSLEFSAMKAEMKGKDKCKSKADPCCKSLTSAERVSEHILKESLTMWNNQKQGNQGKVTNKVCCTSKDEKREKISPSTDSLAKDLIVSALMLIQYHLTQQAKGKDPCEEECPGSSMGYMSQSAQYEKCGGGQSSKSLSMKHFETRGAPGPSTCMKENQLESQKMDMSNMVLSLIQKLLSESPFSCDELTESDNKRCCDPRSSKAAPMAKRPEEQCQDNAELDFISGMKQMNRQFIDQLVESVMKLCLIMAKYSNNGAALAELEEQAALVGSGSRCGRDAMMSQNYSETPGPEVIVNNQCSTTNLQKQLQAVLQWIAASQFNVPMLYFMGDDDGQLEKLPEVSAKAAEKGYSVGDLLQEVMKFAKERQLDEAVGNMARKQLLDWLLANL
Sequence Length
661
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Akap4 recombinant protein
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
92,854 Da
NCBI Official Full Name
A-kinase anchor protein 4 isoform b
NCBI Official Synonym Full Names
A kinase (PRKA) anchor protein 4
NCBI Official Symbol
Akap4
NCBI Official Synonym Symbols
p82; Fsc1; PRKA4; AKAP-4; AKAP82; mAKAP82
NCBI Protein Information
A-kinase anchor protein 4
UniProt Protein Name
A-kinase anchor protein 4
Protein Family
UniProt Gene Name
Akap4
UniProt Synonym Gene Names
Akap82; Fsc1; AKAP-4; AKAP 82; mAKAP82; PRKA4
Uniprot Description
Major structural component of sperm fibrous sheath. Plays a role in sperm motility (PubMed:12167408).
Research Articles on Akap4
Similar Products
Product Notes
The Akap4 akap4 (Catalog #AAA1291181) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 189-849, Full length protein. The amino acid sequence is listed below: QSPSNPATKS PSNQRSVATP EGECSMDDLS FYVNRLSSLV IQMARKEIKD KLEGGSKCLH HSMYTSGDKG KTSPRSAVSK IASEMAHEAV ELTSSEMRGN GEDCRDGRKT FLYSEMCNKN KCGEKQQMCP KDSKEFADSI SKGLMVYANQ VASDMMVSVM KTLKVHSCGK PIPACVVLKR VLLKHTKEIV SDLIDSCMKN LHNITGVLMT DSDFVSAVKR NLFNHGKQNA ADIMEAMLKR LVSALLGEKK ETKSQSLAYA TLKAGTNDPK CKNQSLEFSA MKAEMKGKDK CKSKADPCCK SLTSAERVSE HILKESLTMW NNQKQGNQGK VTNKVCCTSK DEKREKISPS TDSLAKDLIV SALMLIQYHL TQQAKGKDPC EEECPGSSMG YMSQSAQYEK CGGGQSSKSL SMKHFETRGA PGPSTCMKEN QLESQKMDMS NMVLSLIQKL LSESPFSCDE LTESDNKRCC DPRSSKAAPM AKRPEEQCQD NAELDFISGM KQMNRQFIDQ LVESVMKLCL IMAKYSNNGA ALAELEEQAA LVGSGSRCGR DAMMSQNYSE TPGPEVIVNN QCSTTNLQKQ LQAVLQWIAA SQFNVPMLYF MGDDDGQLEK LPEVSAKAAE KGYSVGDLLQ EVMKFAKERQ LDEAVGNMAR KQLLDWLLAN L. It is sometimes possible for the material contained within the vial of "A-kinase anchor protein 4 (Akap4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
