SDS-Page
BRCA1-associated protein (BRAP) Recombinant Protein | BRAP recombinant protein
Recombinant Human BRCA1-associated protein (BRAP)
Gene Names
BRAP; IMP; BRAP2; RNF52
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BRCA1-associated protein (BRAP); Recombinant Human BRCA1-associated protein (BRAP); BRAP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-592aa, full length protein
Sequence
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK
Sequence Length
592
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for BRAP recombinant protein
This protein was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69.3 kDa
NCBI Official Full Name
BRCA1-associated protein
NCBI Official Synonym Full Names
BRCA1 associated protein
NCBI Official Symbol
BRAP
NCBI Official Synonym Symbols
IMP; BRAP2; RNF52
NCBI Protein Information
BRCA1-associated protein
UniProt Protein Name
BRCA1-associated protein
Protein Family
UniProt Gene Name
BRAP
UniProt Synonym Gene Names
IMP
NCBI Description
The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm. [provided by RefSeq, Jul 2008]
Uniprot Description
Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.
Research Articles on BRAP
1. IMPACT data were consistent with increased risks of onset among BRCA1 and BRCA2 mutation carriers
Similar Products
Product Notes
The BRAP brap (Catalog #AAA1284886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-592aa, full length protein. The amino acid sequence is listed below: MSVSLVVIRL ELAEHSPVPA GFGFSAAAGE MSDEEIKKTT LASAVACLEG KSPGEKVAII HQHLGRREMT DVIIETMKSN PDELKTTVEE RKSSEASPTA QRSKDHSKEC INAAPDSPSK QLPDQISFFS GNPSVEIVHG IMHLYKTNKM TSLKEDVRRS AMLCILTVPA AMTSHDLMKF VAPFNEVIEQ MKIIRDSTPN QYMVLIKFRA QADADSFYMT CNGRQFNSIE DDVCQLVYVE RAEVLKSEDG ASLPVMDLTE LPKCTVCLER MDESVNGILT TLCNHSFHSQ CLQRWDDTTC PVCRYCQTPE PVEENKCFEC GVQENLWICL ICGHIGCGRY VSRHAYKHFE ETQHTYAMQL TNHRVWDYAG DNYVHRLVAS KTDGKIVQYE CEGDTCQEEK IDALQLEYSY LLTSQLESQR IYWENKIVRI EKDTAEEINN MKTKFKETIE KCDNLEHKLN DLLKEKQSVE RKCTQLNTKV AKLTNELKEE QEMNKCLRAN QVLLQNKLKE EERVLKETCD QKDLQITEIQ EQLRDVMFYL ETQQKINHLP AETRQEIQEG QINIAMASAS SPASSGGSGK LPSRKGRSKR GK. It is sometimes possible for the material contained within the vial of "BRCA1-associated protein (BRAP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
