Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Perilipin-5 (Plin5) Recombinant Protein | Plin5 recombinant protein

Recombinant Mouse Perilipin-5 (Plin5)

Gene Names
Plin5; MLDP; Lsdp5; PAT-1; AI415325; AW109675; 2310076L09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Perilipin-5 (Plin5); Recombinant Mouse Perilipin-5 (Plin5); Plin5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-463, full length protein
Sequence
MDQRGEDTTLAPHSRMSGDQTAQDPGSSLGELDQQNVVNRVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVDLAQRGRRWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELIQHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALAGCVRGLPPSAQAKVAEVQRSVDALQATFADAHCLGDVAPTALAEGRGSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF
Sequence Length
463
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,778 Da
NCBI Official Full Name
perilipin-5
NCBI Official Synonym Full Names
perilipin 5
NCBI Official Symbol
Plin5
NCBI Official Synonym Symbols
MLDP; Lsdp5; PAT-1; AI415325; AW109675; 2310076L09Rik
NCBI Protein Information
perilipin-5
UniProt Protein Name
Perilipin-5
Protein Family
UniProt Gene Name
Plin5
UniProt Synonym Gene Names
Lsdp5; Mldp; Oxpat; Pat1

Uniprot Description

Lipid droplet-associated protein that maintains the balance between lipogenesis and lipolysis and also regulates fatty acid oxidation in oxidative tissues. Recruits mitochondria to the surface of lipid droplets and is involved in lipid droplet homeostasis by regulating both the storage of fatty acids in the form of triglycerides and the release of fatty acids for mitochondrial fatty acid oxidation. In lipid droplet triacylglycerol hydrolysis, plays a role as a scaffolding protein for three major key lipolytic players: ABHD5, PNPLA2 and LIPE. Reduces the triacylglycerol hydrolase activity of PNPLA2 by recruiting and sequestering PNPLA2 to lipid droplets. Phosphorylation by PKA enables lipolysis probably by promoting release of ABHD5 from the perilipin scaffold and by facilitating interaction of ABHD5 with PNPLA2. Also increases lipolysis through interaction with LIPE and upon PKA-mediated phosphorylation of LIPE.

Research Articles on Plin5

Similar Products

Product Notes

The Plin5 plin5 (Catalog #AAA1282064) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-463, full length protein. The amino acid sequence is listed below: MDQRGEDTTL APHSRMSGDQ TAQDPGSSLG ELDQQNVVNR VVALPLVKAT CTAVSSAYNS AKDRHPLLGS ACRLAEHCVC SVTTCALDHA QPLLEHLQPQ LATVNDLACR GLDKLEEKLP FLQQPSDMVV TSAKDTVAKS VTGMVDLAQR GRRWSGELRR SMSQAMDMVL GKSEKLVDRF LPMTEAELAV LAAEAEGPEV GTVEEQRQQQ GYFVRLGSLS ARLRHLAYEH SLGKLRQSKH RTQEMLAQLQ ETLELIQHMQ RGASPSPTFH PPKTQELWGS WSPCLENGRS HSEVELETLA LSRSLTLELQ NAVDALAGCV RGLPPSAQAK VAEVQRSVDA LQATFADAHC LGDVAPTALA EGRGSVARAH ACVDEFLDLV LRAMPLPWLV GPFAPILVEQ SEPLINLATC VDEVVGDPDP RWAHMDWPAQ KRAWEAESAD PGGQEAEPPR GQGKHTMMPE LDF. It is sometimes possible for the material contained within the vial of "Perilipin-5 (Plin5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.