Neutral trehalase Recombinant Protein | NTH recombinant protein

Recombinant Baker's yeast Neutral trehalase

Cat. Num. AAA1265242

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Neutral trehalase; Recombinant Baker's yeast Neutral trehalase; Alpha; alpha-trehalase; alpha-trehalose glucohydrolase; NTH recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 3-221aa; Partial
• Sequence: QVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAK
• Sequence Length: 751

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

References

Molecular analysis of the neutral trehalase gene from Saccharomyces cerevisiae.Kopp M., Mueller H., Holzer H.J. Biol. Chem. 268:4766-4774(1993) Corrected sequence of the yeast neutral trehalase-encoding gene (NTH1) biological implications.Kopp M., Nwaka S., Holzer H.Gene 150:403-404(1994) The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.Jacq C., Alt-Moerbe J., Andre B., Arnold W., Bahr A., Ballesta J.P.G., Bargues M., Baron L., Becker A., Biteau N., Bloecker H., Blugeon C., Boskovic J., Brandt P., Brueckner M., Buitrago M.J., Coster F., Delaveau T., del Rey F., Dujon B., Eide L.G., Garcia-Cantalejo J.M., Goffeau A., Gomez-Peris A., Granotier C., Hanemann V., Hankeln T., Hoheisel J.D., Jaeger W., Jimenez A., Jonniaux J.-L., Kraemer C., Kuester H., Laamanen P., Legros Y., Louis E.J., Moeller-Rieker S., Monnet A., Moro M., Mueller-Auer S., Nussbaumer B., Paricio N., Paulin L., Perea J., Perez-Alonso M., Perez-Ortin J.E., Pohl T.M., Prydz H., Purnelle B., Rasmussen S.W., Remacha M.A., Revuelta J.L., Rieger M., Salom D., Saluz H.P., Saiz J.E., Saren A.-M., Schaefer M., Scharfe M., Schmidt E.R., Schneider C., Scholler P., Schwarz S., Soler-Mira A., Urrestarazu L.A., Verhasselt P., Vissers S., Voet M., Volckaert G., Wagner G., Wambutt R., Wedler E., Wedler H., Woelfl S., Harris D.E., Bowman S., Brown D., Churcher C.M., Connor R., Dedman K., Gentles S., Hamlin N., Hunt S., Jones L., McDonald S., Murphy L.D., Niblett D., Odell C., Oliver K., Rajandream M.A., Richards C., Shore L., Walsh S.V., Barrell B.G., Dietrich F.S., Mulligan J.T., Allen E., Araujo R., Aviles E., Berno A., Carpenter J., Chen E., Cherry J.M., Chung E., Duncan M., Hunicke-Smith S., Hyman R.W., Komp C., Lashkari D., Lew H., Lin D., Mosedale D., Nakahara K., Namath A., Oefner P., Oh C., Petel F.X., Roberts D., Schramm S., Schroeder M., Shogren T., Shroff N., Winant A., Yelton M.A., Botstein D., Davis R.W., Johnston M., Andrews S., Brinkman R., Cooper J., Ding H., Du Z., Favello A., Fulton L., Gattung S., Greco T., Hallsworth K., Hawkins J., Hillier L.W., Jier M., Johnson D., Johnston L., Kirsten J., Kucaba T., Langston Y., Latreille P., Le T., Mardis E., Menezes S., Miller N., Nhan M., Pauley A., Peluso D., Rifkin L., Riles L., Taich A., Trevaskis E., Vignati D., Wilcox L., Wohldman P., Vaudin M., Wilson R., Waterston R., Albermann K., Hani J., Heumann K., Kleine K., Mewes H.-W., Zollner A., Zaccaria P.Nature 387:75-78(1997) ) Structure and sequence of the centromeric DNA of chromosome 4 in Saccharomyces cerevisiae.Mann C., Davis R.W.Mol. Cell. Biol. 6:241-245(1986) Purification and characterization of neutral trehalase from the yeast ABYS1 mutant.App H., Holzer H.J. Biol. Chem. 264:17583-17588(1989) Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003) Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J., Mann M., Jensen O.N.Mol. Cell. Proteomics 4:310-327(2005) Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J., Elias J.E., Gygi S.P.J. Proteome Res. 6:1190-1197(2007) Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L., Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007) A multidimensional chromatography technology for in-depth phosphoproteome analysis.Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.Mol. Cell. Proteomics 7:1389-1396(2008) Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.Holt L.J., Tuch B.B., Villen J., Johnson A.D., Gygi S.P., Morgan D.O.Science 325:1682-1686(2009) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 6320204
• NCBI GeneID: 851564
• NCBI Accession #: NP_010284.1
• NCBI GenBank Nucleotide #: NM_001180309.1
• UniProt Accession #: P32356; D6VRY8; E9P9U7
• Molecular Weight: 28.8 kDa
• NCBI Official Full Name: alpha,alpha-trehalase NTH1
• NCBI Official Symbol: NTH1
• NCBI Protein Information: alpha,alpha-trehalase NTH1
• UniProt Protein Name: Neutral trehalase
• Protein Family: Neutral trehalase
• UniProt Gene Name: NTH1
• UniProt Synonym Gene Names: NTH
• UniProt Entry Name: TREA_YEAST

Uniprot Description

Miscellaneous: Present with 1840 molecules/cell in log phase SD medium.