Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Eukaryotic translation initiation factor 4E-binding protein 2 Recombinant Protein | EIF4EBP2 recombinant protein

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 2

Gene Names
EIF4EBP2; 4EBP2; PHASII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 4E-binding protein 2; Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 2; EIF4EBP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-120aa; Full Length
Sequence
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Sequence Length
120
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for EIF4EBP2 recombinant protein
Repressor of translation initiation involved in synaptic plasticity, learning and mory formation. Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal st cell renewal via its ability to repress translation initiation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
Product Categories/Family for EIF4EBP2 recombinant protein
References
Insulin-dependent stimulation of protein synthesis by phosphorylation of a regulator of 5'-cap function.Pause A., Belsham G.J., Gingras A.-C., Donze O., Lin T.-A., Lawrence J.C. Jr., Sonenberg N.Nature 371:762-767(1994)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.9 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4E-binding protein 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E binding protein 2
NCBI Official Symbol
EIF4EBP2
NCBI Official Synonym Symbols
4EBP2; PHASII
NCBI Protein Information
eukaryotic translation initiation factor 4E-binding protein 2
UniProt Protein Name
Eukaryotic translation initiation factor 4E-binding protein 2
UniProt Gene Name
EIF4EBP2
UniProt Synonym Gene Names
eIF4E-binding protein 2
UniProt Entry Name
4EBP2_HUMAN

NCBI Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]

Uniprot Description

4E-BP2: eukaryotic translation initiation factor 4E binding protein 2

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 10q21-q22

Cellular Component: cytoplasm

Molecular Function: eukaryotic initiation factor 4E binding; protein binding; translation repressor activity

Biological Process: cAMP-mediated signaling; insulin receptor signaling pathway; memory; negative regulation of translational initiation; regulation of synaptic plasticity; regulation of synaptic transmission; social behavior; TOR signaling pathway; translation

Research Articles on EIF4EBP2

Similar Products

Product Notes

The EIF4EBP2 eif4ebp2 (Catalog #AAA1265209) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-120aa; Full Length. The amino acid sequence is listed below: MSSSAGSGHQ PSQSRAIPTR TVAISDAAQL PHDYCTTPGG TLFSTTPGGT RIIYDRKFLL DRRNSPMAQT PPCHLPNIPG VTSPGTLIED SKVEVNNLNN LNNHDRKHAV GDDAQFEMDI. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 4E-binding protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.