SDS-Page
pro-Natriuretic peptides B Recombinant Protein | NPPB recombinant protein
Recombinant Rat pro-Natriuretic peptides B
Gene Names
Nppb; BNP; Bnf
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
pro-Natriuretic peptides B; Recombinant Rat pro-Natriuretic peptides B; Gamma-brain natriuretic peptide; NPPB recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
77-121
Sequence
PLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Sequence Length
121
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for NPPB recombinant protein
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
References
Cloning and sequence analysis of cDNA encoding a precursor for rat brain natriuretic peptide.Kojima M., Minamino N., Kangawa K., Matsuo H.Biochem. Biophys. Res. Commun. 159:1420-1426(1989)
Organization of the gene for iso-rANP, a rat B-type natriuretic peptide.Roy R.N., Flynn T.G.Biochem. Biophys. Res. Commun. 171:416-423(1990)
Differential expression of natriuretic peptide genes in cardiac and extracardiac tissues.Dagnino L., Drouin J., Nemer M.Mol. Endocrinol. 5:1292-1300(1991)
Isolation and identification of rat brain natriuretic peptides in cardiac atrium.Abuyara M., Hino J., Minamino N., Kangawa K., Matsuo H.Biochem. Biophys. Res. Commun. 163:226-232(1989)
Isolation and sequence determination of rat cardiac natriuretic peptide.Kambayashi Y., Nakao K., Itoh H., Hosoda K., Saito Y., Yamada T., Mukoyama M., Arai H., Shirikami G., Suga S., Ogawa Y., Jougasaki M., Minamino N., Kangawa K., Matsuo H., Inouye K., Imura H.Biochem. Biophys. Res. Commun. 163:233-240(1989)
Isolation and characterization of iso-rANP, a new natriuretic peptide from rat atria.Flynn T.G., Brar A., Tremblay L., Sarda I., Lyons C., Jennings D.B.Biochem. Biophys. Res. Commun. 161:830-837(1989)
Occurrence of a novel cardiac natriuretic peptide in rats.Itoh H., Nakao K., Kambayashi Y., Hosoda K., Saito Y., Yamada T., Mukoyama M., Arai H., Shirakami G., Suga S., Yoshida I., Inouye K., Imura H.Biochem. Biophys. Res. Commun. 161:732-739(1989)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kD
NCBI Official Full Name
natriuretic peptides B
NCBI Official Synonym Full Names
natriuretic peptide B
NCBI Official Symbol
Nppb
NCBI Official Synonym Symbols
BNP; Bnf
NCBI Protein Information
natriuretic peptides B
UniProt Protein Name
Natriuretic peptides B
Protein Family
UniProt Gene Name
Nppb
UniProt Entry Name
ANFB_RAT
NCBI Description
hormone produced primarily by the atrium and ventricle of the heart [RGD, Feb 2006]
Uniprot Description
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 ().
Research Articles on NPPB
Similar Products
Product Notes
The NPPB nppb (Catalog #AAA1265175) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 77-121. The amino acid sequence is listed below: PLGSPSQSPE QSTMQKLLEL IREKSEEMAQ RQLSKDQGPT KELLKRVLRS QDSAFRIQER LRNSKMAHSS SCFGQKIDRI GAVSRLGCDG LRLF. It is sometimes possible for the material contained within the vial of "pro-Natriuretic peptides B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
