Centromere DNA-binding protein complex CBF3 subunit C (CTF13) Recombinant Protein | CTF13 recombinant protein

Recombinant Saccharomyces cerevisiae Centromere DNA-binding protein complex CBF3 subunit C (CTF13)

Cat. Num. AAA1263882

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Centromere DNA-binding protein complex CBF3 subunit C (CTF13); Recombinant Saccharomyces cerevisiae Centromere DNA-binding protein complex CBF3 subunit C (CTF13); CTF13 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-478, full length protein
• Sequence: PSFNPVRFLELPIDIRKEVYFHLDGNFCGAHPYPIDILYKSNDVELPGKPSYKRSKRSKKLLRYMYPVFATYLNIFEYSPQLIEKWLEYAFWLRYDCLVLDCFKVNHLYDGTLIDALEWTYLDNELRLAYFNKASMLEVWYTFKEYKKWVIDSVAFDELDLLNVSNIQFNIDNLTPQLVDKCLSILEQKDLFATIGEVQFGQDEEVGEEKDVDVSGANSDENSSPSSTIKNKKRSASKRSHSDNGNVGATHNQLTSISVIRTIRSMESMKSLRKITVRGEKLYELLINFHGFRDNPGKTISYIVKRRINEIRLSRMNQISRTGLADFTRWDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKIKWWNIEENILKELKVDKRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSFRTLNHIKLQNVSEVFNNIIVPRALFDSKRVEIYRCEKISQVLVI
• Sequence Length: 477

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6323741
• NCBI GeneID: 855119
• NCBI Accession #: NP_013812.1
• NCBI GenBank Nucleotide #: NM_001182594.1
• UniProt Accession #: P35203; D6VZR7
• Molecular Weight: 56,336 Da
• NCBI Official Full Name: Ctf13p
• NCBI Official Symbol: CTF13
• NCBI Protein Information: Ctf13p
• UniProt Protein Name: Centromere DNA-binding protein complex CBF3 subunit C
• Protein Family: Centromere DNA-binding protein complex
• UniProt Gene Name: CTF13
• UniProt Synonym Gene Names: CBF3C

Uniprot Description

Acts as central component of the centromere DNA-binding protein complex CBF3, which is essential for chromosome segregation and movement of centromeres along microtubules. CBF3 is required for the recruitment of other kinetochore complexes to CEN DNA. It plays a role in the attachment of chromosomes to the spindle and binds selectively to a highly conserved DNA sequence called CDEIII, found in centromers and in several promoters. The association of CBF3C with CBF3D and SGT1 is required for CBF3C activation and CBF3 assembly.