Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor-like 2 (Ccrl2) Recombinant Protein | Ccrl2 recombinant protein

Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2)

Gene Names
Ccrl2; E01; CCR11; L-CCR; Cmkbr1l2; 1810047I05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor-like 2 (Ccrl2); Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2); Recombinant C-C chemokine receptor-like 2 (Ccrl2); C-C chemokine receptor-like 2; Chemokine receptor CCR11 G-protein coupled beta chemokine receptor Lipopolysacharide-inducible C-C chemokine receptor; L-CCR; Ccrl2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-360
Sequence
MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCCAVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPGNGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMATALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFIICCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYHLDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPREGHGRPIELYSNLHQRQDII
Sequence Length
360
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,745 Da
NCBI Official Full Name
C-C chemokine receptor-like 2
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor-like 2
NCBI Official Symbol
Ccrl2
NCBI Official Synonym Symbols
E01; CCR11; L-CCR; Cmkbr1l2; 1810047I05Rik
NCBI Protein Information
C-C chemokine receptor-like 2; chemokine receptor CCR11; chemokine (C-C) receptor 1-like 2; chemokine (C-C) receptor 1,-like 2; G-protein coupled beta chemokine receptor; lipopolysacharide-inducible C-C chemokine receptor; lipopolysaccharide-inducible C-C chemokine receptor; lipopolysaccharide inducible C-C chemokine receptor related
UniProt Protein Name
C-C chemokine receptor-like 2
Protein Family
UniProt Gene Name
Ccrl2
UniProt Synonym Gene Names
Ccr11; Lccr; L-CCR
UniProt Entry Name
CCRL2_MOUSE

Uniprot Description

CCRL2: Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: CCR chemokine receptor binding; G-protein coupled receptor activity; signal transducer activity; chemokine receptor binding; C-C chemokine receptor activity; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; chemotaxis; signal transduction; inflammatory response

Research Articles on Ccrl2

Similar Products

Product Notes

The Ccrl2 ccrl2 (Catalog #AAA1262381) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-360. The amino acid sequence is listed below: MDNYTVAPDD EYDVLILDDY LDNSGPDQVP APEFLSPQQV LQFCCAVFAV GLLDNVLAVF ILVKYKGLKN LGNIYFLNLA LSNLCFLLPL PFWAHTAAHG ESPGNGTCKV LVGLHSSGLY SEVFSNILLL VQGYRVFSQG RLASIFTTVS CGIVACILAW AMATALSLPE SVFYEPRMER QKHKCAFGKP HFLPIEAPLW KYVLTSKMII LVLAFPLLVF IICCRQLRRR QSFRERQYDL HKPALVITGV FLLMWAPYNT VLFLSAFQEH LSLQDEKSSY HLDASVQVTQ LVATTHCCVN PLLYLLLDRK AFMRYLRSLF PRCNDIPYQS SGGYQQAPPR EGHGRPIELY SNLHQRQDII. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor-like 2 (Ccrl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.