FeS cluster assembly protein sufB (sufB) Recombinant Protein | sufB recombinant protein
Recombinant Escherichia coli FeS cluster assembly protein sufB (sufB)
Gene Names
sufB; ECK1679; JW5273; ynhE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FeS cluster assembly protein sufB (sufB); Recombinant Escherichia coli FeS cluster assembly protein sufB (sufB); sufB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-495, full length protein
Sequence
MSRNTEATDDVKTWTGGPLNYKEGFFTQLATDELAKGINEEVVRAISAKRNEPEWMLEFRLNAYRAWLEMEEPHWLKAHYDKLNYQDYSYYSAPSCGNCDDTCASEPGAVQQTGANAFLSKEVEAAFEQLGVPVREGKEVAVDAIFDSVSVATTYREKLAEQGIIFCSFGEAIHDHPELVRKYLGTVVPGNDNFFAALNAAVASDGTFIYVPKGVRCPMELSTYFRINAEKTGQFERTILVADEDSYVSYIEGCSAPVRDSYQLHAAVVEVIIHKNAEVKYSTVQNWFPGDNNTGGILNFVTKRALCEGENSKMSWTQSETGSAITWKYPSCILRGDNSIGEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGANCGAHTFPYVECRNNSAQLEHEATTSRIGEDQLFYCLQRGISEEDAISMIVNGFCKDVFSELPLEFAVEAQKLLAISLEHSVG
Sequence Length
495
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,745 Da
NCBI Official Full Name
component of SufBCD Fe-S cluster assembly scaffold
NCBI Official Symbol
sufB
NCBI Official Synonym Symbols
ECK1679; JW5273; ynhE
NCBI Protein Information
component of SufBCD Fe-S cluster assembly scaffold
UniProt Protein Name
FeS cluster assembly protein SufB
Protein Family
UniProt Gene Name
sufB
UniProt Synonym Gene Names
ynhE
NCBI Description
SufBCD increases SufSE cysteine desulfurase activity and involved in iron acquisition. [More information is available at EcoGene: EG13965]. The SufB-SufC-SufD complex activates the cysteine desulfurase activity SufS in conjunction with the SufE sulfur acceptor protein . [More information is available at EcoCyc: G6909].
Uniprot Description
The SufBCD complex acts synergistically with SufE to stimulate the cysteine desulfurase activity of SufS. The SufBCD complex contributes to the assembly or repair of oxygen-labile iron-sulfur clusters under oxidative stress. May facilitate iron uptake from extracellular iron chelators under iron limitation.
Research Articles on sufB
Similar Products
Product Notes
The sufB sufb (Catalog #AAA1261563) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-495, full length protein. The amino acid sequence is listed below: MSRNTEATDD VKTWTGGPLN YKEGFFTQLA TDELAKGINE EVVRAISAKR NEPEWMLEFR LNAYRAWLEM EEPHWLKAHY DKLNYQDYSY YSAPSCGNCD DTCASEPGAV QQTGANAFLS KEVEAAFEQL GVPVREGKEV AVDAIFDSVS VATTYREKLA EQGIIFCSFG EAIHDHPELV RKYLGTVVPG NDNFFAALNA AVASDGTFIY VPKGVRCPME LSTYFRINAE KTGQFERTIL VADEDSYVSY IEGCSAPVRD SYQLHAAVVE VIIHKNAEVK YSTVQNWFPG DNNTGGILNF VTKRALCEGE NSKMSWTQSE TGSAITWKYP SCILRGDNSI GEFYSVALTS GHQQADTGTK MIHIGKNTKS TIISKGISAG HSQNSYRGLV KIMPTATNAR NFTQCDSMLI GANCGAHTFP YVECRNNSAQ LEHEATTSRI GEDQLFYCLQ RGISEEDAIS MIVNGFCKDV FSELPLEFAV EAQKLLAISL EHSVG. It is sometimes possible for the material contained within the vial of "FeS cluster assembly protein sufB (sufB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
