Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CAAX prenyl protease 2 (RCE1) Recombinant Protein | RCE1 recombinant protein

Recombinant Bovine CAAX prenyl protease 2 (RCE1)

Gene Names
RCE1; FACE-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CAAX prenyl protease 2 (RCE1); Recombinant Bovine CAAX prenyl protease 2 (RCE1); Recombinant CAAX prenyl protease 2 (RCE1); CAAX prenyl protease 2 EC= 3.4.22.-; Farnesylated proteins-converting enzyme 2; FACE-2 Prenyl protein-specific endoprotease 2 RCE1 homolog; RCE1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-308
Sequence
MAALGGDGFRLLSVSRPERQPESAALGGPGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIFEQLRFRQSSVGSIFLSAGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS
Sequence Length
308
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,455 Da
NCBI Official Full Name
CAAX prenyl protease 2
NCBI Official Symbol
RCE1
NCBI Official Synonym Symbols
FACE-2
NCBI Protein Information
CAAX prenyl protease 2; prenyl protein peptidase RCE1; CAAX prenyl protein protease RCE1; Prenyl protein-specific endoprotease 2; RCE1 homolog, prenyl protein peptidase; Farnesylated proteins-converting enzyme 2
UniProt Protein Name
CAAX prenyl protease 2
UniProt Gene Name
RCE1
UniProt Synonym Gene Names
FACE-2
UniProt Entry Name
FACE2_BOVIN

Uniprot Description

Function: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the peptidase U48 family.

Similar Products

Product Notes

The RCE1 rce1 (Catalog #AAA1253515) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308. The amino acid sequence is listed below: MAALGGDGFR LLSVSRPERQ PESAALGGPG PGLCCWVSVF SCLSLACSYV GSLYVWKSEL PRDHPAVIKR RFTSVLVVSS LSPLCVLLWR ELTGIQPGTS LLTLMGFRLE GIFPAALLPL LLTMILFLGP LMQLSMDCPC DLADGLKVVL APRSWARCLT DMRWLRNQVI APLTEELVFR ACMLPMLAPC TGLGPAVFTC PLFFGVAHFH HIFEQLRFRQ SSVGSIFLSA GHLIGPVLCH SFCNYMGFPA VCAALEHPQR RPLLAGYALG VGLFLLLLQP LTDPKLYGSL PLCVLLERAG DSEAPLCS. It is sometimes possible for the material contained within the vial of "CAAX prenyl protease 2 (RCE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.