Early E3 18.5 kDa glycoprotein Recombinant Protein | E19 recombinant protein
Recombinant Human adenovirus B serotype 11 Early E3 18.5 kDa glycoprotein, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Early E3 18.5 kDa glycoprotein; Recombinant Human adenovirus B serotype 11 Early E3 18.5 kDa glycoprotein; partial; E19 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-166
Sequence
NYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPQWYTVSVRGPDGSIRISNNTFIFSKMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
Sequence Length
166
Species
Human adenovirus B serotype 11 (strain BC34) (HAdV-11) (Human adenovirus 11A (strain BC34))
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
18,548 Da
NCBI Official Full Name
Early E3 18.5 kDa glycoprotein
UniProt Protein Name
Early E3 18.5 kDa glycoprotein
Protein Family
UniProt Gene Name
E19
UniProt Synonym Gene Names
E19
Uniprot Description
Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes ().
Similar Products
Product Notes
The Early E3 18.5 kDa glycoprotein e19 (Catalog #AAA1249542) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-166. The amino acid sequence is listed below: NYDPCLDFDP ENCTLTFAPD TSRICGVLIK CGWECRSVEI THNNKTWNNT LSTTWEPGVP QWYTVSVRGP DGSIRISNNT FIFSKMCDLA MFMSKQYSLW PPSKDNIVTF SIAYCLCACL LTALLCVCIH LLVTTRIKNA NNKEKMP. It is sometimes possible for the material contained within the vial of "Early E3 18.5 kDa glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
