Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CEAM5Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Horse, Human CEACAM5 Polyclonal Antibody | anti-CEACAM5 antibody

CEACAM5 Antibody - N-terminal region

Gene Names
CEACAM5; CEA; CD66e
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEACAM5; Polyclonal Antibody; CEACAM5 Antibody - N-terminal region; anti-CEACAM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE
Sequence Length
702
Applicable Applications for anti-CEACAM5 antibody
Western Blot (WB)
Homology
Horse: 90%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEAM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CEAM5Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CEAM5Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CEACAM5 antibody
This is a rabbit polyclonal antibody against CEAM5. It was validated on Western Blot

Target Description: This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CEACAM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
Carcinoembryonic antigen-related cell adhesion molecule 5
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 5
NCBI Official Symbol
CEACAM5
NCBI Official Synonym Symbols
CEA; CD66e
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 5
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 5
UniProt Gene Name
CEACAM5
UniProt Synonym Gene Names
CEA; CEA
UniProt Entry Name
CEAM5_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

Uniprot Description

CEACAM5: Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins. Homodimer. Binding of E.coli Dr adhesins leads to dissociation of the homodimer. Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon. Belongs to the immunoglobulin superfamily. CEA family.

Protein type: Membrane protein, integral; Immunoglobulin superfamily; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 19q13.1-q13.2

Cellular Component: basolateral plasma membrane; integral to plasma membrane

Molecular Function: identical protein binding; protein homodimerization activity

Biological Process: homotypic cell-cell adhesion; negative regulation of apoptosis

Research Articles on CEACAM5

Similar Products

Product Notes

The CEACAM5 ceacam5 (Catalog #AAA3200204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEACAM5 Antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEACAM5 ceacam5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MESPSAPPHR WCIPWQRLLL TASLLTFWNP PTTAKLTIES TPFNVAEGKE. It is sometimes possible for the material contained within the vial of "CEACAM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.