SDS-PAGE
Glutamate-pyruvate aminotransferase AlaC Recombinant Protein | alaC recombinant protein
Recombinant Escherichia coli (strain K12) Glutamate-pyruvate aminotransferase AlaC
Gene Names
alaC; ECK2375; JW2376; yfdZ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate-pyruvate aminotransferase AlaC; Recombinant Escherichia coli (strain K12) Glutamate-pyruvate aminotransferase AlaC; alaC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-412aa; Full Length
Sequence
MADTRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKAMFRADGLLPASSKHIHENAE
Sequence Length
412
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for alaC recombinant protein
Involved in the biosynthesis of alanine.
References
Construction of a contiguous 874-kb sequence of the Escherichia coli-K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features.Yamamoto Y., Aiba H., Baba T., Hayashi K., Inada T., Isono K., Itoh T., Kimura S., Kitagawa M., Makino K., Miki T., Mitsuhashi N., Mizobuchi K., Mori H., Nakade S., Nakamura Y., Nashimoto H., Oshima T., Oyama S., Saito N., Sampei G., Satoh Y., Sivasundaram S., Tagami H., Takahashi H., Takeda J., Takemoto K., Uehara K., Wada C., Yamagata S., Horiuchi T.DNA Res. 4:91-113(1997)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
The novel transcription factor SgrR coordinates the response to glucose-phosphate stress.Vanderpool C.K., Gottesman S.J. Bacteriol. 189:2238-2248(2007)
Genetics and regulation of the major enzymes of alanine synthesis in Escherichia coli.Kim S.H., Schneider B.L., Reitzer L.J. Bacteriol. 192:5304-5311(2010)
Isolation of a mutant auxotrophic for L-alanine and identification of three major aminotransferases that synthesize L-alanine in Escherichia coli.Yoneyama H., Hori H., Lim S.J., Murata T., Ando T., Isogai E., Katsumata R.Biosci. Biotechnol. Biochem. 75:930-938(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.2 kDa
NCBI Official Full Name
glutamate-pyruvate aminotransferase; glutamic-pyruvic transaminase (GPT); alanine transaminase
NCBI Official Symbol
alaC
NCBI Official Synonym Symbols
ECK2375; JW2376; yfdZ
NCBI Protein Information
glutamate-pyruvate aminotransferase; glutamic-pyruvic transaminase (GPT); alanine transaminase
UniProt Protein Name
Glutamate-pyruvate aminotransferase AlaC
Protein Family
UniProt Gene Name
alaC
UniProt Synonym Gene Names
yfdZ
UniProt Entry Name
ALAC_ECOLI
NCBI Description
AFMB Structural Genomics target Number 22 (http://afmb.cnrs-mrs.fr/article171.html). [More information is available at EcoGene: EG14198]. Expression of yfdZ is activated by the transcriptional regulator SgrR. [More information is available at EcoCyc: G7242].
Uniprot Description
Involved in the biosynthesis of alanine.
Research Articles on alaC
Similar Products
Product Notes
The alaC alac (Catalog #AAA1246834) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-412aa; Full Length. The amino acid sequence is listed below: MADTRPERRF TRIDRLPPYV FNITAELKMA ARRRGEDIID FSMGNPDGAT PPHIVEKLCT VAQRPDTHGY STSRGIPRLR RAISRWYQDR YDVEIDPESE AIVTIGSKEG LAHLMLATLD HGDTVLVPNP SYPIHIYGAV IAGAQVRSVP LVEGVDFFNE LERAIRESYP KPKMMILGFP SNPTAQCVEL EFFEKVVALA KRYDVLVVHD LAYADIVYDG WKAPSIMQVP GARDVAVEFF TLSKSYNMAG WRIGFMVGNK TLVSALARIK SYHDYGTFTP LQVAAIAALE GDQQCVRDIA EQYKRRRDVL VKGLHEAGWM VEMPKASMYV WAKIPEPYAA MGSLEFAKKL LNEAKVCVSP GIGFGDYGDT HVRFALIENR DRIRQAIRGI KAMFRADGLL PASSKHIHEN AE. It is sometimes possible for the material contained within the vial of "Glutamate-pyruvate aminotransferase AlaC, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
