Apolipoprotein C-I (Apoc1) Recombinant Protein | Apoc1\r recombinant protein

Recombinant Mouse Apolipoprotein C-I (Apoc1)

Cat. Num. AAA1243529

• Gene Names: Apoc1; apo-CI; apoC-I; Apo-CIB; ApoC-IB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein C-I (Apoc1); Recombinant Mouse Apolipoprotein C-I (Apoc1); Apoc1\r recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 27-88, full length protein
• Sequence: APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
• Sequence Length: 62

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 158517825
• NCBI GeneID: 11812
• NCBI Accession #: NP_001103479.1
• NCBI GenBank Nucleotide #: NM_001110009.2
• UniProt Accession #: P34928; Q505B2
• Molecular Weight: 9,696 Da
• NCBI Official Full Name: apolipoprotein C-I
• NCBI Official Synonym Full Names: apolipoprotein C-I
• NCBI Official Symbol: Apoc1
• NCBI Official Synonym Symbols: apo-CI; apoC-I; Apo-CIB; ApoC-IB
• NCBI Protein Information: apolipoprotein C-I
• UniProt Protein Name: Apolipoprotein C-I
• UniProt Gene Name: Apoc1
• UniProt Synonym Gene Names: Apo-CI; ApoC-I

NCBI Description

This gene encodes a precursor plasma protein that is cleaved to yield a signal peptide and two alternatively processed mature peptides. The encoded protein, which is a component of chylomicrons, very low density lipoproteins and high density lipoproteins, transports lipids from the intestines to other locations in the body. This protein binds to free fatty acids preventing their uptake by cells. This protein is a cofactor for lecithin cholesterol acyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. The encoded protein inhibits the activity of the cholesteryl ester transfer protein which promotes the exchange of neutral lipids between lipoproteins. In humans this gene is associated with risk of coronary artery disease and age-associated memory impairment. Mice lacking this gene demonstrate impaired memory. This gene is clustered with three other apolipoprotein genes on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (). Binds free fatty acids and reduces their intracellular esterification.