Werner Syndrome-like exonuclease (WRNexo) Recombinant Protein | WRNexo recombinant protein
Recombinant Drosophila yakuba Werner Syndrome-like exonuclease (WRNexo)
Gene Names
DyakGE25207; dyak_GLEANR_8833; GE25207
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Werner Syndrome-like exonuclease (WRNexo); Recombinant Drosophila yakuba Werner Syndrome-like exonuclease (WRNexo); WRNexo recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354, full length protein
Sequence
MEKYLIKMPIKSKANAVPEEKAVVKKGTPKMTGKVTKKDTPKELKDKENAGEDNTPKQTKGRPGRPAVKRKNLDNPDAKAEKKATEEENPPKRRSSRLTRSTRSMAEDGSPSPEKEKPEKLPFIKYKGAIKYYTENQDIAASADDVLQWVEKQKDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNLKKLPAVLVALINHPKVRLHGVNIKNDFRKLARDFPEVSAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERREKAKIKNEAEFKENNGEAAFKAMKTLGETFLTKINEVTL
Sequence Length
354
Species
Drosophila yakuba (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,333 Da
NCBI Official Full Name
uncharacterized protein Dyak_GE25207
NCBI Official Symbol
DyakGE25207
NCBI Official Synonym Symbols
dyak_GLEANR_8833; GE25207
NCBI Protein Information
GE25207 gene product from transcript GE25207-RB
UniProt Protein Name
Werner Syndrome-like exonuclease
UniProt Gene Name
WRNexo
Uniprot Description
Essential for the formation of DNA replication focal centers. Has an important role in maintaining genome stability. Has exonuclease activity on both single-stranded and duplex templates bearing overhangs, but not blunt ended duplex DNA, and cleaves in a 3'-5' direction ().
Similar Products
Product Notes
The WRNexo wrnexo (Catalog #AAA1237001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354, full length protein. The amino acid sequence is listed below: MEKYLIKMPI KSKANAVPEE KAVVKKGTPK MTGKVTKKDT PKELKDKENA GEDNTPKQTK GRPGRPAVKR KNLDNPDAKA EKKATEEENP PKRRSSRLTR STRSMAEDGS PSPEKEKPEK LPFIKYKGAI KYYTENQDIA ASADDVLQWV EKQKDEVVPM AFDMEWPFSF QTGPGKSAVI QICVDEKCCY IYQLTNLKKL PAVLVALINH PKVRLHGVNI KNDFRKLARD FPEVSAEPLI EKCVDLGLWC NEVCETGGRW SLERLTNFIA KKAMDKSKKV RMSKWHVIPL DENQLMYAAI DVYIGQVIYR ELERREKAKI KNEAEFKENN GEAAFKAMKT LGETFLTKIN EVTL. It is sometimes possible for the material contained within the vial of "Werner Syndrome-like exonuclease (WRNexo), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
