Nitrile-specifier protein 2 (NSP2) Recombinant Protein | NSP2 recombinant protein
Recombinant Arabidopsis thaliana Nitrile-specifier protein 2 (NSP2)
Gene Names
NSP2; ATNSP2; F25I18.19; F25I18_19; nitrile specifier protein 2; NITRILE-SPECIFIER PROTEIN 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nitrile-specifier protein 2 (NSP2); Recombinant Arabidopsis thaliana Nitrile-specifier protein 2 (NSP2); NSP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-471, Full length protein
Sequence
MVQKVEARGGEIGDVWDDGAYDGVRKVYVGQGEDGIAFVKFEYVNGSQEVVGDERGKKTLLGAEEFEVDPDDYIVYVEGYHEKVFGVTTKEIISTLTFKTYKGKTSPPFGIVSGTKFVLQGGKIVGFHGRSTDVLHSLGAYISSPATPKLRGKWIKVEQKGEGPGPRCSHDIAQVGNKIFSFGGELTPNQPIDKHLYVFDLETRTWSISPATGDVPNLSCLGVRMVSIGSSLYVFGGRDASRKYNGFYSFDTTKNEWKLLTPVEQGPTPRSFHSMTADENNVYVFGGVSATVRLKTLDAYNIVDHKWVQCSTPGGSCSVRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPAQDKWTQVETFGEKPCARSVFASAVVGKHILVFGGEIAMDPKAHEGPGQLSGGTFALDTETLKWEKLDKLGEEEETPSIRGWSASTTGTIDGKKGLVMFGGKAQTNDRFGDLFFYGVDSA
Sequence Length
471
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,413 Da
NCBI Official Full Name
nitrile specifier protein 2
NCBI Official Symbol
NSP2
NCBI Official Synonym Symbols
ATNSP2; F25I18.19; F25I18_19; nitrile specifier protein 2; NITRILE-SPECIFIER PROTEIN 2
NCBI Protein Information
nitrile specifier protein 2
UniProt Protein Name
Nitrile-specifier protein 2
Protein Family
UniProt Gene Name
NSP2
UniProt Synonym Gene Names
JAL21; AtNSP2
NCBI Description
Encodes a nitrile-specifier protein NSP2. NSP2 is one out of five (At3g16400/NSP1, At2g33070/NSP2, At3g16390/NSP3, At3g16410/NSP4 and At5g48180/NSP5) A. thaliana epithiospecifier protein (ESP) homologues that promote simple nitrile, but not epithionitrile or thiocyanate formation.
Uniprot Description
Promotes simple nitriles, but not epithionitrile or thiocyanate formation. Converts allylglucosinolate and benzylglucosinolate to their corresponding simple nitriles in the presence of myrosinase.
Research Articles on NSP2
Similar Products
Product Notes
The NSP2 nsp2 (Catalog #AAA1236204) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-471, Full length protein. The amino acid sequence is listed below: MVQKVEARGG EIGDVWDDGA YDGVRKVYVG QGEDGIAFVK FEYVNGSQEV VGDERGKKTL LGAEEFEVDP DDYIVYVEGY HEKVFGVTTK EIISTLTFKT YKGKTSPPFG IVSGTKFVLQ GGKIVGFHGR STDVLHSLGA YISSPATPKL RGKWIKVEQK GEGPGPRCSH DIAQVGNKIF SFGGELTPNQ PIDKHLYVFD LETRTWSISP ATGDVPNLSC LGVRMVSIGS SLYVFGGRDA SRKYNGFYSF DTTKNEWKLL TPVEQGPTPR SFHSMTADEN NVYVFGGVSA TVRLKTLDAY NIVDHKWVQC STPGGSCSVR GGAGLEVVQG KVWVVYGFNG CEVDDVHCYD PAQDKWTQVE TFGEKPCARS VFASAVVGKH ILVFGGEIAM DPKAHEGPGQ LSGGTFALDT ETLKWEKLDK LGEEEETPSI RGWSASTTGT IDGKKGLVMF GGKAQTNDRF GDLFFYGVDS A. It is sometimes possible for the material contained within the vial of "Nitrile-specifier protein 2 (NSP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
