Large envelope protein (S) Recombinant Protein | S recombinant protein

Recombinant Woolly monkey hepatitis B virus Large envelope protein (S)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Large envelope protein (S); Recombinant Woolly monkey hepatitis B virus Large envelope protein (S); Recombinant Large envelope protein (S); Large envelope protein; L glycoprotein L-HBsAg; LHB Large S protein Large surface protein Major surface antigen; S recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-391
• Sequence: GLNQSTFNPLGFFPSHQLDPLFKANAGSADWDKNPNKDPWPQAHDTAVGAFGPGLVPPHGGLLGWSSQAQGLSVTVPDTPPPPSTNRDKGRKPTPATPPLRDTHPQAMTWNTSSFQSYLQNPKVRGLYFPAGGSTSSIVNPVPTTASTTSSSFSTTGVPVSTMDITSSGFLGPLLALQAVFFLLTKILTMPQSLDSLWTSLNFLGGTPACPGLNSQSPTSSHSPTCCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPTVTGTTTTTGPCRTCTPIVPGISSYPSCCCTKPTDGNCTCIPIPSSWAFAKFLWDWALARFSWLNSLLPFVQWFAGLSPTVWLLVIWMMWFWGPSLFSILSPFLPLLPLFFWLWAYI
• Sequence Length: 391

• Species: Woolly monkey hepatitis B virus (isolate Louisville) (WMHBV)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 82016122
• UniProt Accession #: O71305; O92934
• Molecular Weight: 42,557 Da
• NCBI Official Full Name: Large envelope protein
• UniProt Protein Name: Large envelope protein
• UniProt Gene Name: S
• UniProt Synonym Gene Names: LHB
• UniProt Entry Name: HBSAG_WMHBV

Uniprot Description

Function: The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. The large envelope protein probably also assumes fusion between virion and host membranes. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein

By similarity.The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid

By similarity.

Subunit structure: Li-HBsAg interacts with capsid protein and with HDV Large delta antigen. Isoform M associates with host chaperone CANX through its pre-S2 N glycan. This association may be essential for M proper secretion

By similarity.

Subcellular location: Virion membrane

By similarity.

Domain: The large envelope protein is synthesized with the pre-S region at the cytosolic side of the endoplasmic reticulum and, hence will be within the virion after budding. Therefore the pre-S region is not N-glycosylated. Later a post-translational translocation of N-terminal pre-S and TM1 domains occur in about 50% of proteins at the virion surface. These molecules change their topology by an unknown mechanism, resulting in exposure of pre-S region at virion surface. For isoform M in contrast, the pre-S2 region is translocated cotranslationally to the endoplasmic reticulum lumen and is N-glycosylated.

Post-translational modification: Isoform M is N-terminally acetylated at a ratio of 90%, and N-glycosylated at the pre-S2 region

By similarity.Myristoylated

By similarity.

Sequence similarities: Belongs to the orthohepadnavirus major surface antigen family.

Sequence caution: The sequence AAC16906.1 differs from that shown. Reason: Erroneous initiation. The sequence AAO74857.1 differs from that shown. Reason: Erroneous initiation.