Early growth response protein 1 (EGR1) Recombinant Protein | EGR1 recombinant protein
Recombinant Chicken Early growth response protein 1 (EGR1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Early growth response protein 1 (EGR1); Recombinant Chicken Early growth response protein 1 (EGR1); EGR1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194, Full length protein
Sequence
CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKVEKAASVSATSSSVAAYSSSVATSYSSSIATTYPSSVRTVYSSPASSSYPSPAHTTFPSPSIATTYSSGTATFQTQVATSFPSPGVTNNFSSQVTSALSDMTSTFSPRTIEIC
Sequence Length
194
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EGR1 recombinant protein
This protein belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
21,308 Da
NCBI Official Full Name
Early growth response protein 1
NCBI Official Synonym Full Names
early growth response 1
NCBI Official Symbol
EGR1
NCBI Protein Information
early growth response protein 1
UniProt Protein Name
Early growth response protein 1
Protein Family
UniProt Gene Name
EGR1
UniProt Synonym Gene Names
; EGR-1
Uniprot Description
Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (). Binds double-stranded target DNA, irrespective of the cytosine methylation status (). Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Mediates responses to ischemia and hypoxia; regulates the expression of proteins that are involved in inflammatory processes ().
Research Articles on EGR1
Similar Products
Product Notes
The EGR1 egr1 (Catalog #AAA1223503) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194, Full length protein. The amino acid sequence is listed below: CDRRFSRSDE LTRHIRIHTG QKPFQCRICM RNFSRSDHLT THIRTHTGEK PFACDICGRK FARSDERKRH TKIHLRQKDK KVEKAASVSA TSSSVAAYSS SVATSYSSSI ATTYPSSVRT VYSSPASSSY PSPAHTTFPS PSIATTYSSG TATFQTQVAT SFPSPGVTNN FSSQVTSALS DMTSTFSPRT IEIC. It is sometimes possible for the material contained within the vial of "Early growth response protein 1 (EGR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
