Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) Recombinant Protein | mtgA recombinant protein
Recombinant Salmonella agona Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA); Recombinant Salmonella agona Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA); Recombinant Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA); Monofunctional biosynthetic peptidoglycan transglycosylase; Monofunctional TGase EC= 2.4.2.-; mtgA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-242
Sequence
MSKRRIAPLTFLRRLLLRILAALAVFWGGGIALFSVVPVPFSAVMAERQISAWLGGEFGYVAHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWDGRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQRYFHKPASRLNMSEAALLAAVLPNPLRYKANAPSGYVRSRQAWIMRQMRQLGGESFMTRNQLN
Sequence Length
242
Species
Salmonella agona (strain SL483)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,061 Da
NCBI Official Full Name
monofunctional biosynthetic peptidoglycan transglycosylase
NCBI Official Symbol
mtgA
NCBI Protein Information
monofunctional biosynthetic peptidoglycan transglycosylase
UniProt Protein Name
Monofunctional biosynthetic peptidoglycan transglycosylase
Protein Family
UniProt Gene Name
mtgA
UniProt Synonym Gene Names
Monofunctional TGase
UniProt Entry Name
MTGA_SALA4
Uniprot Description
Function: Cell wall formation
By similarity. HAMAP-Rule MF_00766
Pathway: Cell wall biogenesis; peptidoglycan biosynthesis. HAMAP-Rule MF_00766
Subcellular location: Cell membrane; Single-pass membrane protein
Potential HAMAP-Rule MF_00766.
Sequence similarities: Belongs to the glycosyltransferase 51 family.
Similar Products
Product Notes
The mtgA mtga (Catalog #AAA1223036) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-242. The amino acid sequence is listed below: MSKRRIAPLT FLRRLLLRIL AALAVFWGGG IALFSVVPVP FSAVMAERQI SAWLGGEFGY VAHSDWVSMA DISPWMGLAV IAAEDQKFPE HWGFDVPAIE KALAHNERNE SRIRGASTLS QQTAKNLFLW DGRSWLRKGL EAGLTLGIET VWSKKRILTV YLNIAEFGDG IFGVEAAAQR YFHKPASRLN MSEAALLAAV LPNPLRYKAN APSGYVRSRQ AWIMRQMRQL GGESFMTRNQ LN. It is sometimes possible for the material contained within the vial of "Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
