Arylamine N-acetyltransferase, liver isozyme Recombinant Protein | NAT recombinant protein
Recombinant Chicken Arylamine N-acetyltransferase, liver isozyme
Gene Names
NAT; LNAT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arylamine N-acetyltransferase; liver isozyme; Recombinant Chicken Arylamine N-acetyltransferase; NAT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-287, Full length protein
Sequence
MNIQEYFSRISFDGSHKDADLQTLTAIFQHHIQAIPFENLSMHCGETIDLDLQATYNKIVKKKRGGWCMETNYLLFWALKEMGYDICVLGGNSYEPAKKAYTDEINHILLKVVIKGSSYIVDAGFGGGPYQTWLPMLLISGKDQPQIPGIFRFIEDNGIWYLEKVKRKHYVPEGSVPLTDNPEMGNIRKLYSFTLEPKHIDDFQELNAYLQVAPDTILQKKSICSLQTTDGFYALVGWTFSEMKYKYKEDADLLQTTTLTDEEVEKTLKDKFNIVLENKLIPVNVRG
Sequence Length
287
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,915 Da
NCBI Official Full Name
arylamine N-acetyltransferase, liver isozyme
NCBI Official Synonym Full Names
N-acetyltransferase, liver isozyme
NCBI Official Symbol
NAT
NCBI Official Synonym Symbols
LNAT
NCBI Protein Information
arylamine N-acetyltransferase, liver isozyme
UniProt Protein Name
Arylamine N-acetyltransferase, liver isozyme
Protein Family
UniProt Gene Name
Arylamine acetylase
UniProt Synonym Gene Names
Arylamine acetylase
Research Articles on NAT
Similar Products
Product Notes
The NAT arylamine acetylase (Catalog #AAA1218940) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-287, Full length protein. The amino acid sequence is listed below: MNIQEYFSRI SFDGSHKDAD LQTLTAIFQH HIQAIPFENL SMHCGETIDL DLQATYNKIV KKKRGGWCME TNYLLFWALK EMGYDICVLG GNSYEPAKKA YTDEINHILL KVVIKGSSYI VDAGFGGGPY QTWLPMLLIS GKDQPQIPGI FRFIEDNGIW YLEKVKRKHY VPEGSVPLTD NPEMGNIRKL YSFTLEPKHI DDFQELNAYL QVAPDTILQK KSICSLQTTD GFYALVGWTF SEMKYKYKED ADLLQTTTLT DEEVEKTLKD KFNIVLENKL IPVNVRG. It is sometimes possible for the material contained within the vial of "Arylamine N-acetyltransferase, liver isozyme, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
