Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Late embryogenesis abundant protein D-113 Recombinant Protein | LEA D-113 recombinant protein

Recombinant Gossypium hirsutum Late embryogenesis abundant protein D-113

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Late embryogenesis abundant protein D-113; Recombinant Gossypium hirsutum Late embryogenesis abundant protein D-113; LEA D-113 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-165, Full length protein
Sequence
MQSMKDAAASAKAGMEKAKASMQEKVDQMKTRDPNEKEMARERKEERQEDAELRKQEARHHNATAGHVGGGGIGGTGYTTAGYNIGDTGGYGGTGGHDNRGYPTAGSGYDTGRQDDLSSMGFGGDTEGAYGTTGNQDFPNAASNNAGTRRNTRGGTQDDPYYRSY
Sequence Length
165
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
17,488 Da
NCBI Official Full Name
Late embryogenesis abundant protein D-113
UniProt Protein Name
Late embryogenesis abundant protein D-113
UniProt Gene Name
LEA D-113
UniProt Synonym Gene Names
LEA D-113

Uniprot Description

LEA proteins are late embryonic proteins abundant in higher plant seed embryos. There are two subsets of LEA proteins (5a and 5b), the first ones are expressed when the cotyledon weight reach 80 mg and the second set are expressed above 100 mg. The function of those proteins is not known.

Similar Products

Product Notes

The Late embryogenesis abundant protein D-113 lea d-113 (Catalog #AAA1218387) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-165, Full length protein. The amino acid sequence is listed below: MQSMKDAAAS AKAGMEKAKA SMQEKVDQMK TRDPNEKEMA RERKEERQED AELRKQEARH HNATAGHVGG GGIGGTGYTT AGYNIGDTGG YGGTGGHDNR GYPTAGSGYD TGRQDDLSSM GFGGDTEGAY GTTGNQDFPN AASNNAGTRR NTRGGTQDDP YYRSY. It is sometimes possible for the material contained within the vial of "Late embryogenesis abundant protein D-113, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.