Coronatine-insensitive protein 1 (COI1) Recombinant Protein | COI1 recombinant protein

Recombinant Arabidopsis thaliana Coronatine-insensitive protein 1 (COI1) , partial

Cat. Num. AAA1214466

• Gene Names: COI1; CORONATINE INSENSITIVE 1; T28M21.10; T28M21_10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Coronatine-insensitive protein 1 (COI1); Recombinant Arabidopsis thaliana Coronatine-insensitive protein 1 (COI1); partial; COI1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-214. partial
• Sequence: MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLET

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18405209
• NCBI GeneID: 818581
• NCBI Accession #: NP_565919.1
• NCBI GenBank Nucleotide #: NM_129552.4
• UniProt Accession #: O04197; B2BD84
• Molecular Weight: 67,665 Da
• NCBI Official Full Name: RNI-like superfamily protein
• NCBI Official Symbol: COI1
• NCBI Official Synonym Symbols: CORONATINE INSENSITIVE 1; T28M21.10; T28M21_10
• NCBI Protein Information: RNI-like superfamily protein
• UniProt Protein Name: Coronatine-insensitive protein 1
• Protein Family: Coronatine-insensitive protein
• UniProt Gene Name: COI1
• UniProt Synonym Gene Names: FBL2; AtCOI1; AtFBL2

NCBI Description

Encodes a protein containing Leu-rich repeats and a degenerate F-box motif. Associates with AtCUL1, AtRbx1, and the Skp1-like proteins ASK1 and ASK2 to assemble SCF COI1 ubiquitin-ligase complexes in planta. A single amino acid substitution in the F-box motif of COI1 abolishes the formation of the SCF(COI1) complexes and results in loss of the JA response. Required for wound- and jasmonates-induced transcriptional regulation.

Uniprot Description

Required for jasmonate-regulated plant fertility and defense processes, and for coronatine and/or other elicitors perceptions/responses. Seems to not be required for meiosis. Required for the regulation of some genes induced by wounding, but not for all. Component of SCF(COI1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including the ribulose bisphosphate carboxylase small chain 1B RBCS-1B and the histone deacetylase HDA6). These SCF complexes play crucial roles in regulating response to jasmonate, and their interactions with the COP9 signalosome (CSN) appear to be important for their activity. Interacts with TIFY10A and inositol pentakisphosphate to form a high-affinity jasmonates coreceptor. Involved in the regulation of plant gene expression during plant-pathogen interactions with Pseudomonas syringae and Alternaria brassicicola.