Tetratricopeptide repeat protein 30A (ttc30a) Recombinant Protein | flr recombinant protein

Recombinant Danio rerio Tetratricopeptide repeat protein 30A (ttc30a)

Cat. Num. AAA1213002

• Gene Names: flr; ttc30; ttc30a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tetratricopeptide repeat protein 30A (ttc30a); Recombinant Danio rerio Tetratricopeptide repeat protein 30A (ttc30a); Recombinant Tetratricopeptide repeat protein 30A (ttc30a); Tetratricopeptide repeat protein 30A; TPR repeat protein 30A; Protein fleer; flr recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-651
• Sequence: MPPMTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEVTGWNE
• Sequence Length: 651

• Species: Danio rerio (Zebrafish) (Brachydanio rerio)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 157785658
• NCBI GeneID: 797829
• NCBI Accession #: NP_001098119.2
• NCBI GenBank Nucleotide #: NM_001104649.2
• UniProt Accession #: A7YE96; A8CVX5; B3DKN4
• Molecular Weight: 75,523 Da
• NCBI Official Full Name: tetratricopeptide repeat protein 30A
• NCBI Official Synonym Full Names: fleer
• NCBI Official Symbol: flr
• NCBI Official Synonym Symbols: ttc30; ttc30a
• NCBI Protein Information: tetratricopeptide repeat protein 30A; DYF-1; IFT70; protein fleer; TPR repeat protein 30; TPR repeat protein 30A
• UniProt Protein Name: Tetratricopeptide repeat protein 30A
• Protein Family: Flavoredoxin
• UniProt Gene Name: ttc30a
• UniProt Synonym Gene Names: flr; TPR repeat protein 30A
• UniProt Entry Name: TT30A_DANRE

Uniprot Description

Function: Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip

By similarity. Required for polyglutamylation of axonemal tubulin, which is a prerequisite for correct assembly of cilia and for normal cilia beat amplitude. Does not seem to be required for neuronal microtubule polyglutamylation. Ref.1

Subcellular location: Cell projection › cilium Ref.1.

Tissue specificity: Localizes to the cilia of many ciliated epithelial cell types including pronephric cells, olfactory placode, the brain ventricle and lateral line organs. Ref.1

Developmental stage: Maternally expressed. First detected in Kupffer's vesicle of seven somite embryos and the lateral mesoderm of 11 somite embryos. By 24 to 30 hours post-fertilization (hpf), expression becomes widespread within the central nervous system and the pronephros and parallels the development of multiciliated cells. During later stages of larval development (54 hpf), expression continues throughout the pronephros and intensifies in the olfactory placode and lateral line organs. Ref.1

Sequence similarities: Belongs to the TTC30/dfy-1/fleer family.Contains 8 TPR repeats.

Sequence caution: The sequence ABV08791.1 differs from that shown. Reason: Erroneous initiation.