Large-conductance mechanosensitive channel (mscL) Recombinant Protein | mscL recombinant protein
Recombinant Escherichia coli Large-conductance mechanosensitive channel (mscL)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Large-conductance mechanosensitive channel (mscL); Recombinant Escherichia coli Large-conductance mechanosensitive channel (mscL); mscL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-136
Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Sequence Length
136
Species
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for mscL recombinant protein
mscL
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,957 Da
NCBI Official Full Name
large-conductance mechanosensitive channel
NCBI Official Symbol
mscL
NCBI Protein Information
large-conductance mechanosensitive channel
UniProt Protein Name
Large-conductance mechanosensitive channel
Protein Family
UniProt Gene Name
mscL
UniProt Entry Name
MSCL_ECOLC
Uniprot Description
Function: Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell
By similarity. HAMAP-Rule MF_00115
Subunit structure: Homopentamer
By similarity. HAMAP-Rule MF_00115
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00115.
Sequence similarities: Belongs to the MscL family.
Similar Products
Product Notes
The mscL mscl (Catalog #AAA1194757) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-136. The amino acid sequence is listed below: MSIIKEFREF AMRGNVVDLA VGVIIGAAFG KIVSSLVADI IMPPLGLLIG GIDFKQFAVT LRDAQGDIPA VVMHYGVFIQ NVFDFLIVAF AIFMAIKLIN KLNRKKEEPA AAPAPTKEEV LLTEIRDLLK EQNNRS. It is sometimes possible for the material contained within the vial of "Large-conductance mechanosensitive channel (mscL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
